NEK7 Recombinant Protein Antigen

Images

 
There are currently no images for NEK7 Protein (NBP1-86457PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NEK7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NEK7.

Source: E.coli

Amino Acid Sequence: MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVAL

Protein/Peptide Type
Recombinant Protein Antigen
Gene
NEK7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-86457.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NEK7 Recombinant Protein Antigen

  • EC 2.7.11.1
  • Never in mitosis A-related kinase 7
  • NIMA (never in mitosis gene a)-related kinase 7
  • NimA-related protein kinase 7
  • serine/threonine-protein kinase Nek7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47865
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00091754-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00004751-M11
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-82883
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP1-82539
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00121441-M05
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-181
Species: Hu, Mu, Rt, Po, Dr
Applications: WB, ICC/IF, IP
AF877
Species: Hu
Applications: WB, IHC, IP
NB100-56537
Species: Hu, Mu
Applications: WB, ChIP, IP
NBP2-13650
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-04991
Species: Hu
Applications: ICC/IF (-), WB
AF3064
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-87196
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00079858-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-37445
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
H00152110-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-86457PEP
Species: Hu
Applications: AC

Publications for NEK7 Protein (NBP1-86457PEP) (0)

There are no publications for NEK7 Protein (NBP1-86457PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEK7 Protein (NBP1-86457PEP) (0)

There are no reviews for NEK7 Protein (NBP1-86457PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for NEK7 Protein (NBP1-86457PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NEK7 Products

Bioinformatics Tool for NEK7 Protein (NBP1-86457PEP)

Discover related pathways, diseases and genes to NEK7 Protein (NBP1-86457PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NEK7 Protein (NBP1-86457PEP)

Discover more about diseases related to NEK7 Protein (NBP1-86457PEP).
 

Pathways for NEK7 Protein (NBP1-86457PEP)

View related products by pathway.

PTMs for NEK7 Protein (NBP1-86457PEP)

Learn more about PTMs related to NEK7 Protein (NBP1-86457PEP).
 

Research Areas for NEK7 Protein (NBP1-86457PEP)

Find related products by research area.

Blogs on NEK7

There are no specific blogs for NEK7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Eg5 Antibody
NB500-181
Eg5 Antibody
NB500-181
NEK7 Antibody
NBP1-31110
NEK7 Antibody
NBP1-31110
NEK7 Antibody
NBP1-31110

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NEK7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NEK7