NEK11 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NEK11 Antibody [NBP1-83584] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: NEK11 Antibody [NBP1-83584] - Staining of human testis shows strong nuclear positivity in subsets of cells in ductus seminiferus.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NEK11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DFGVSRLLMGSCDLATTLTGTPHYMSPEALKHQGYDTKSDIWSLACILYEMCCMNHAFAGSNFLSIVLKIVEGDTPSLPERYPKELNAIMESMLNKNPSLRPSAIEILKIPYLDEQLQNLMC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NEK11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NEK11 Protein (NBP1-83584PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NEK11 Antibody

  • EC 2.7.11
  • EC 2.7.11.1
  • FLJ23495
  • Never in mitosis A-related kinase 11
  • NIMA (never in mitosis gene a)- related kinase 11
  • NimA-related protein kinase 11
  • serine/threonine-protein kinase Nek11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004751-M11
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
H00091754-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
MAB1648
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-82883
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47865
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB7675
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-13650
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31110
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-42686
Species: Hu
Applications: WB (-), IHC, IP
NBP1-82539
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00152110-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF

Publications for NEK11 Antibody (NBP1-83584) (0)

There are no publications for NEK11 Antibody (NBP1-83584).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEK11 Antibody (NBP1-83584) (0)

There are no reviews for NEK11 Antibody (NBP1-83584). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NEK11 Antibody (NBP1-83584) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NEK11 Products

Bioinformatics Tool for NEK11 Antibody (NBP1-83584)

Discover related pathways, diseases and genes to NEK11 Antibody (NBP1-83584). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NEK11 Antibody (NBP1-83584)

Discover more about diseases related to NEK11 Antibody (NBP1-83584).
 

Pathways for NEK11 Antibody (NBP1-83584)

View related products by pathway.

PTMs for NEK11 Antibody (NBP1-83584)

Learn more about PTMs related to NEK11 Antibody (NBP1-83584).
 

Research Areas for NEK11 Antibody (NBP1-83584)

Find related products by research area.

Blogs on NEK11

There are no specific blogs for NEK11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NEK11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NEK11