NEDD9/CASL/HEF1 Recombinant Protein Antigen

Images

 
There are currently no images for NEDD9/CASL/HEF1 Recombinant Protein Antigen (NBP3-17640PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NEDD9/CASL/HEF1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NEDD9/CASL/HEF1

Source: E. coli

Amino Acid Sequence: ILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRVKLLIGPMQETASSHEQPASGLMQQTFGQQKLYQVPNPQAAPRDTIYQVPPSYQNQGIYQVPTGHGTQEQEVYQVPPS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NEDD9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17640.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NEDD9/CASL/HEF1 Recombinant Protein Antigen

  • Cas scaffolding protein family member 2
  • CAS2
  • CASL
  • CAS-LCASS2cas-like docking
  • CASLdJ49G10.2
  • CRK-associated substrate-related protein
  • dJ49G10.2 (Enhancer of Filamentation 1 (HEF1))
  • dJ761I2.1 (enhancer of filamentation (HEF1))
  • dJ761I2.1
  • enhancer of filamentation 1
  • HEF1
  • HEF1Crk-associated substrate related
  • NEDD9
  • NEDD-9
  • Neural precursor cell expressed developmentally down-regulated protein 9
  • neural precursor cell expressed, developmentally down-regulated 9
  • p105
  • Renal carcinoma antigen NY-REN-12

Background

HEF1, also known as Enhancer of filamentation 1, CRKassociated substrate-related protein, CAS-L, CasL, p105 and Neural precursor cell expressed developmentally down-regulated 9 is the product of the NEDD9 (CASGL) gene. HEF1 functions as a docking protein that plays a central coordinating role for tyrosine-kinase-based signaling related to cell adhesion. HEF1 may also function in transmitting growth control signals between focal adhesions at the cell periphery and the mitotic spindle in response to adhesion or growth factor signals initiating cell proliferation. HEF1 may also play an important role in integrin beta-1 or B cell antigen receptor (BCR) mediated signaling in B- and T-cells. Integrin beta-1 stimulation leads to recruitment of various proteins including CRK, NCK and SHPTP2 to the tyrosine phosphorylated form. HEF1 forms a homodimer and can heterodimerize with HLH proteins ID2, E12, E47 and also with p130cas. HEF1 also forms complexes in vivo with related adhesion focal tyrosine kinase (RAFTK), adapter protein CRKL and LYN kinase and also interacts with MICAL and TXNL4/DIM1. This protein localizes to both the cell nucleus and the cell periphery and is differently localized in fibroblasts and epithelial cells. In fibroblasts, it is predominantly nuclear and in some cells is present in the Golgi apparatus. In epithelial cells, it is localized predominantly in the cell periphery with particular concentration in lamellipodia, but it is also found in the nucleus. HEF1 is widely expressed although higher levels are detected in kidney, lung, and placental tissue. HEF1 is also detected in T-cells, B-cells and diverse cell lines. HEF1 is activated upon induction of cell growth. Cell cycle-regulated processing produces four isoforms: p115, p105, p65, and p55. Isoform p115 arises from p105 phosphorylation and appears later in the cell cycle. Isoform p55 arises from p105 as a result of cleavage at a caspase cleavage-related site and it appears specifically at mitosis. The p65 isoform is poorly detected. Isoforms p105 and p115 are predominantly cytoplasmic and associate with focal adhesions while p55 associates with the mitotic spindle.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00532
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-67327
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
H00001434-M08
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-31993
Species: Hu
Applications: IHC,  IHC-P, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
MAB6210
Species: Hu
Applications: Simple Western, WB
NBP2-38206
Species: Hu
Applications: IHC,  IHC-P, KD, WB
NBP3-38210
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-82455
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
AF5414
Species: Hu
Applications: Simple Western, WB
MAB17781
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
AF4259
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
NBP1-84621
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-03107
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-32752
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KO, WB
H00057091-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP3-17640PEP
Species: Hu
Applications: AC

Publications for NEDD9/CASL/HEF1 Recombinant Protein Antigen (NBP3-17640PEP) (0)

There are no publications for NEDD9/CASL/HEF1 Recombinant Protein Antigen (NBP3-17640PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEDD9/CASL/HEF1 Recombinant Protein Antigen (NBP3-17640PEP) (0)

There are no reviews for NEDD9/CASL/HEF1 Recombinant Protein Antigen (NBP3-17640PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NEDD9/CASL/HEF1 Recombinant Protein Antigen (NBP3-17640PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NEDD9/CASL/HEF1 Products

Blogs on NEDD9/CASL/HEF1

There are no specific blogs for NEDD9/CASL/HEF1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NEDD9/CASL/HEF1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NEDD9