Nectin-4/PVRL4 Recombinant Protein Antigen

Images

 
There are currently no images for Nectin-4/PVRL4 Protein (NBP1-82829PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Nectin-4/PVRL4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PVRL4.

Source: E. coli

Amino Acid Sequence: KLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVLVPPLPSLNPGPAL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NECTIN4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82829.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Nectin-4/PVRL4 Recombinant Protein Antigen

  • EDSS1
  • Ig superfamily receptor LNIR
  • LNIR
  • LNIRnectin 4
  • Nectin4
  • Nectin-4
  • poliovirus receptor-related 4
  • poliovirus receptor-related protein 4
  • PRR4
  • PRR4DKFZp686K05193
  • PVRL4

Background

PVRL4, also known as Poliovirus receptor-related protein 4, is a 510 amino acid protein that is 55 kDa, predominantly expressed in placenta and breast carcinoma, is a single-pass type I membrane protein involved in cell adhesion through trans-homophilic and -heterophilic interactions, the latter including specifically interactions with PVRL2/nectin-1, and oes not act as receptor for alpha-herpesvirus entry into cells. Disease research is being performed in relation to this protein and ectodermal dysplasia, syndactyly, ectodermal dysplasia-syndactyly syndrome 1, measles, ovarian cancer, breast carcinoma, lung cancer, and carcinoma. The PVRL4 protein has shown an interaction with PVRL1, MLLT4, PICK1, TIGIT, PARD3, PVRL3, and PVRL2 in Adherens junctions interactions, Nectin/Necl trans heterodimerization, Cell junction organization, Cell-Cell communication, Cell-cell junction organization, Sertoli-Sertoli Cell Junction Dynamics, and Epithelial Adherens Junctions pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4330
Species: Mu
Applications: CyTOF-ready, Flow, WB
MAB2005
Species: Hu
Applications: CyTOF-ready, Flow, WB
MAB25301
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
NBP2-34594
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P
NBP3-41306
Species: Hu, Mu, Rt
Applications: WB
AF4478
Species: Hu
Applications: IHC, WB
AF3064
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NB300-186
Species: Hu, Rt
Applications: ICC/IF, Simple Western, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF761
Species: Mu
Applications: AdBlk, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, Simple Western, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
AF2605
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-82829PEP
Species: Hu
Applications: AC

Publications for Nectin-4/PVRL4 Protein (NBP1-82829PEP) (0)

There are no publications for Nectin-4/PVRL4 Protein (NBP1-82829PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nectin-4/PVRL4 Protein (NBP1-82829PEP) (0)

There are no reviews for Nectin-4/PVRL4 Protein (NBP1-82829PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Nectin-4/PVRL4 Protein (NBP1-82829PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Nectin-4/PVRL4 Products

Blogs on Nectin-4/PVRL4

There are no specific blogs for Nectin-4/PVRL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Nectin-4/PVRL4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NECTIN4