Ndufs4 Antibody (3F11)

Images

 
Western Blot: Ndufs4 Antibody (3F11) [H00004724-M03] - Analysis of NDUFS4 expression in human kidney.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3F11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Ndufs4 Antibody (3F11) Summary

Immunogen
NDUFS4 (NP_002486, 66 a.a. - 175 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK
Specificity
NDUFS4 - NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase) (3F11)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NDUFS4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Ndufs4 Antibody (3F11)

  • AQDQ
  • AQDQmitochondrial
  • CI-18 kDa
  • NADH dehydrogenase (ubiquinone) Fe-S protein 4 (18kD) (NADH-coenzyme Qreductase)
  • NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Qreductase)
  • NADH-coenzyme Q reductase, 18-KD
  • NADH-ubiquinone oxidoreductase 18 kDa subunit

Background

This gene encodes an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), or NADH:ubiquinone oxidoreductase, the first multi-subunit enzyme complex of the mitochondrial respiratory chain. Complex I plays a vital role in cellular ATP production, the primary source of energy for many crucial processes in living cells. It removes electrons from NADH and passes them by a series of different protein-coupled redox centers to the electron acceptor ubiquinone. In well-coupled mitochondria, the electron flux leads to ATP generation via the building of a proton gradient across the inner membrane. Complex I is composed of at least 41 subunits, of which 7 are encoded by the mitochondrial genome and the remainder by nuclear genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31142
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00004723-M01
Species: Hu, Rt
Applications: WB, ELISA, RNAi
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46127
Species: Hu
Applications: WB, IHC
H00374291-P01
Species: Hu
NBP2-49127
Species: Hu
Applications: IHC
NBP1-85620
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88938
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84475
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00004722-M02
Species: Hu
Applications: WB, ELISA, IHC-P, IP, RNAi
NBP2-47359
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47945
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88936
Species: Hu
Applications: IHC, IHC-P

Publications for Ndufs4 Antibody (H00004724-M03) (0)

There are no publications for Ndufs4 Antibody (H00004724-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ndufs4 Antibody (H00004724-M03) (0)

There are no reviews for Ndufs4 Antibody (H00004724-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ndufs4 Antibody (H00004724-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ndufs4 Products

Bioinformatics Tool for Ndufs4 Antibody (H00004724-M03)

Discover related pathways, diseases and genes to Ndufs4 Antibody (H00004724-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ndufs4 Antibody (H00004724-M03)

Discover more about diseases related to Ndufs4 Antibody (H00004724-M03).
 

Pathways for Ndufs4 Antibody (H00004724-M03)

View related products by pathway.

PTMs for Ndufs4 Antibody (H00004724-M03)

Learn more about PTMs related to Ndufs4 Antibody (H00004724-M03).

Blogs on Ndufs4

There are no specific blogs for Ndufs4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ndufs4 Antibody (3F11) and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFS4
Entrez
Uniprot