NDUFB5 Antibody (5G5)

Images

 
Western Blot: NDUFB5 Antibody (5G5) [H00004711-M01] - Analysis of NDUFB5 expression in transfected 293T cell line by NDUFB5 monoclonal antibody (M01), clone 5G5.Lane 1: NDUFB5 transfected lysate(21.8 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
5G5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NDUFB5 Antibody (5G5) Summary

Immunogen
NDUFB5 (NP_002483, 95 a.a. - 189 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QAELAEIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN
Specificity
NDUFB5 - NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NDUFB5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDUFB5 Antibody (5G5)

  • 5 (16kD, SGDH)
  • CISGDH
  • CI-SGDH
  • Complex I-SGDH
  • DKFZp686N02262
  • FLJ30597
  • MGC111204
  • MGC12314
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa
  • NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
  • SGDH

Background

The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00079026-M01
Species: Hu
Applications: WB, ELISA, IP
NBP1-89020
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89715
Species: Hu
Applications: WB, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF4647
Species: Hu
Applications: WB, IHC, IP
NBP1-80860
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15525
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
H00000518-R01
Species: Hu
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-33626
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88929
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31142
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1678
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-80324
Species: Hu
Applications: WB
H00004723-M01
Species: Hu, Rt
Applications: WB, ELISA, RNAi
H00004711-M01
Species: Hu
Applications: WB, ELISA

Publications for NDUFB5 Antibody (H00004711-M01) (0)

There are no publications for NDUFB5 Antibody (H00004711-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFB5 Antibody (H00004711-M01) (0)

There are no reviews for NDUFB5 Antibody (H00004711-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFB5 Antibody (H00004711-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDUFB5 Products

Bioinformatics Tool for NDUFB5 Antibody (H00004711-M01)

Discover related pathways, diseases and genes to NDUFB5 Antibody (H00004711-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFB5 Antibody (H00004711-M01)

Discover more about diseases related to NDUFB5 Antibody (H00004711-M01).
 

Pathways for NDUFB5 Antibody (H00004711-M01)

View related products by pathway.

Blogs on NDUFB5

There are no specific blogs for NDUFB5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFB5 Antibody (5G5) and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFB5
Entrez
OMIM
Uniprot