NDUFB3 Antibody (6C6)

Images

 
Western Blot: NDUFB3 Antibody (6C6) [H00004709-M01] - NDUFB3 monoclonal antibody (M01), clone 6C6. Analysis of NDUFB3 expression in A-431.
Western Blot: NDUFB3 Antibody (6C6) [H00004709-M01] - NDUFB3 monoclonal antibody (M01), clone 6C6 Analysis of NDUFB3 expression in HeLa.
Sandwich ELISA: NDUFB3 Antibody (6C6) [H00004709-M01] - Detection limit for recombinant GST tagged NDUFB3 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
6C6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NDUFB3 Antibody (6C6) Summary

Immunogen
NDUFB3 (NP_002482, 13 a.a. ~ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKSVSFSD
Specificity
NDUFB3 - NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 3, 12kDa
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NDUFB3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDUFB3 Antibody (6C6)

  • 3 (12kD, B12)
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 3, 12kDa

Background

The multisubunit NADH:ubiquinone oxidoreductase (complex I) is the first enzyme complex in the electron transport chain of mitochondria. See NDUFA2 (MIM 602137).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NBP3-17255
Species: Hu
Applications: ICC/IF, WB
NBP1-59069
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-64775
Species: Pm, Bv, Hu, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P (-), IP
NBP2-37607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-73857
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
AF6457
Species: Hu
Applications: WB
NBP2-45946
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-03417
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-83552
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00003703-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, WB
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB

Publications for NDUFB3 Antibody (H00004709-M01) (0)

There are no publications for NDUFB3 Antibody (H00004709-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFB3 Antibody (H00004709-M01) (0)

There are no reviews for NDUFB3 Antibody (H00004709-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFB3 Antibody (H00004709-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDUFB3 Products

Bioinformatics Tool for NDUFB3 Antibody (H00004709-M01)

Discover related pathways, diseases and genes to NDUFB3 Antibody (H00004709-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFB3 Antibody (H00004709-M01)

Discover more about diseases related to NDUFB3 Antibody (H00004709-M01).
 

Pathways for NDUFB3 Antibody (H00004709-M01)

View related products by pathway.

PTMs for NDUFB3 Antibody (H00004709-M01)

Learn more about PTMs related to NDUFB3 Antibody (H00004709-M01).
 

Research Areas for NDUFB3 Antibody (H00004709-M01)

Find related products by research area.

Blogs on NDUFB3

There are no specific blogs for NDUFB3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFB3 Antibody (6C6) and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFB3
Entrez
OMIM
Uniprot