NDST3 Antibody (5B9)

Images

 
Western Blot: NDST3 Antibody (5B9) [H00009348-M01] - NDST3 monoclonal antibody (M01), clone 5B9 Analysis of NDST3 expression in Hela S3 NE.
Sandwich ELISA: NDST3 Antibody (5B9) [H00009348-M01] - Detection limit for recombinant GST tagged NDST3 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
5B9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NDST3 Antibody (5B9) Summary

Immunogen
NDST3 (NP_004775, 162 a.a. ~ 259 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IGFHKTSEKSVQSFQLKGFPFSIYGNLAVKDCCINPHSPLIRVTKSSKLEKGSLPGTDWTVFQINHSAYQPVIFAKVKTPENLSPSISKGAFYATIIH
Localization
Golgi apparatus membrane; Single-pass type II membrane protein.
Specificity
NDST3 - N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NDST3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDST3 Antibody (5B9)

  • bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3
  • EC 2.8.2.8
  • GlcNAc N-deacetylase/ N-sulfotransferase 3
  • Glucosaminyl N-deacetylase/N-sulfotransferase 3
  • hNDST-3
  • HSST3MGC130028
  • MGC130029
  • N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3
  • NDST-3
  • N-heparan sulfate sulfotransferase 3
  • N-HSST 3

Background

NDST3 (N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3) is an essential monomeric enzyme with 2 catalytic activities. It catalyzes both the N-deacetylation and the N-sulfation of N-acetylglucosamine residues (GlcNAc) in heparan sulfate and heparin. NDST3 has high deacetylase activity but low sulfotransferase activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-81747
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
AF6174
Species: Hu
Applications: IHC, IP, WB
H00003340-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
H00064579-D01P
Species: Hu, Rt
Applications: WB
NBP1-92415
Species: Hu
Applications: IHC, IHC-P
AF5057
Species: Hu
Applications: WB
NBP1-76963
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP2-03227
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-69148
Species: Hu, Rt
Applications: ELISA, WB
H00009514-B01P
Species: Hu, Mu
Applications: WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP1-86617
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00010559-P01
Species: Hu
Applications: ELISA, AP, PA, WB

Publications for NDST3 Antibody (H00009348-M01) (0)

There are no publications for NDST3 Antibody (H00009348-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDST3 Antibody (H00009348-M01) (0)

There are no reviews for NDST3 Antibody (H00009348-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDST3 Antibody (H00009348-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDST3 Products

Bioinformatics Tool for NDST3 Antibody (H00009348-M01)

Discover related pathways, diseases and genes to NDST3 Antibody (H00009348-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDST3 Antibody (H00009348-M01)

Discover more about diseases related to NDST3 Antibody (H00009348-M01).
 

Pathways for NDST3 Antibody (H00009348-M01)

View related products by pathway.

PTMs for NDST3 Antibody (H00009348-M01)

Learn more about PTMs related to NDST3 Antibody (H00009348-M01).

Blogs on NDST3

There are no specific blogs for NDST3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDST3 Antibody (5B9) and receive a gift card or discount.

Bioinformatics

Gene Symbol NDST3
Entrez
OMIM
Uniprot