NCOA4 Recombinant Protein Antigen

Images

 
There are currently no images for NCOA4 Recombinant Protein Antigen (NBP2-56237PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NCOA4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NCOA4.

Source: E.coli

Amino Acid Sequence: KSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQ

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NCOA4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-56237. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for NCOA4 Recombinant Protein Antigen

  • Androgen receptor coactivator 70 kDa protein
  • Androgen receptor-associated protein of 70 kDa
  • ARA70RFGret fused
  • DKFZp762E1112
  • ELE1NCoA-4
  • nuclear receptor coactivator 4,70 kDa AR-activator
  • PTC3RET-activating gene ELE1
  • Ret-activating protein ELE1,70 kDa androgen receptor coactivator

Background

The NCOA4 gene encodes an androgen receptor coactivator. The encoded protein interacts with the androgen receptor in a ligand-dependent manner to enhance its transcriptional activity. Chromosomal translocations between this gene and the ret tyrosine kinase gen

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF482
Species: Mu
Applications: IHC, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP1-47945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85351
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DY262
Species: Hu
Applications: ELISA
NBP1-33581
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NB200-310
Species: Hu, Pm, Mu, Rt
Applications: ChIP, IP, WB
AF5626
Species: Hu
Applications: ICC, WB
NBP1-89021
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DKK300
Species: Hu
Applications: ELISA
AF4078
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NLS3775
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
NBP1-47668
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-07996
Species: Hu
Applications: WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-56237PEP
Species: Hu
Applications: AC

Publications for NCOA4 Recombinant Protein Antigen (NBP2-56237PEP) (0)

There are no publications for NCOA4 Recombinant Protein Antigen (NBP2-56237PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCOA4 Recombinant Protein Antigen (NBP2-56237PEP) (0)

There are no reviews for NCOA4 Recombinant Protein Antigen (NBP2-56237PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NCOA4 Recombinant Protein Antigen (NBP2-56237PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NCOA4 Products

Bioinformatics Tool for NCOA4 Recombinant Protein Antigen (NBP2-56237PEP)

Discover related pathways, diseases and genes to NCOA4 Recombinant Protein Antigen (NBP2-56237PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCOA4 Recombinant Protein Antigen (NBP2-56237PEP)

Discover more about diseases related to NCOA4 Recombinant Protein Antigen (NBP2-56237PEP).
 

Pathways for NCOA4 Recombinant Protein Antigen (NBP2-56237PEP)

View related products by pathway.

PTMs for NCOA4 Recombinant Protein Antigen (NBP2-56237PEP)

Learn more about PTMs related to NCOA4 Recombinant Protein Antigen (NBP2-56237PEP).

Blogs on NCOA4

There are no specific blogs for NCOA4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NCOA4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NCOA4