Recombinant Human NCOA4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NCOA4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 505-614 of Human NCOA4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQM

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
NCOA4
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NCOA4 Protein

  • Androgen receptor coactivator 70 kDa protein
  • Androgen receptor-associated protein of 70 kDa
  • ARA70RFGret fused
  • DKFZp762E1112
  • ELE1NCoA-4
  • nuclear receptor coactivator 4,70 kDa AR-activator
  • PTC3RET-activating gene ELE1
  • Ret-activating protein ELE1,70 kDa androgen receptor coactivator

Background

NCOA4 - nuclear receptor coactivator 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF482
Species: Mu
Applications: WB, IHC
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
AF5626
Species: Hu
Applications: WB, ICC
NBP1-89021
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4078
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
H00008031-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for NCOA4 Partial Recombinant Protein (H00008031-Q01) (0)

There are no publications for NCOA4 Partial Recombinant Protein (H00008031-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCOA4 Partial Recombinant Protein (H00008031-Q01) (0)

There are no reviews for NCOA4 Partial Recombinant Protein (H00008031-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NCOA4 Partial Recombinant Protein (H00008031-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NCOA4 Products

Bioinformatics Tool for NCOA4 Partial Recombinant Protein (H00008031-Q01)

Discover related pathways, diseases and genes to NCOA4 Partial Recombinant Protein (H00008031-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCOA4 Partial Recombinant Protein (H00008031-Q01)

Discover more about diseases related to NCOA4 Partial Recombinant Protein (H00008031-Q01).
 

Pathways for NCOA4 Partial Recombinant Protein (H00008031-Q01)

View related products by pathway.

PTMs for NCOA4 Partial Recombinant Protein (H00008031-Q01)

Learn more about PTMs related to NCOA4 Partial Recombinant Protein (H00008031-Q01).

Blogs on NCOA4

There are no specific blogs for NCOA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NCOA4 Antibody (1B7)
H00008031-M04

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NCOA4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NCOA4