We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Nav1.7 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related Nav1.7 Peptides and Proteins

Order Details


    • Catalog Number
      NBP2-57651PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Nav1.7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Nav1.7.

Source: E. coli

Amino Acid Sequence: RAYRRYRLRQNVKNISSIYIKDGDRDDDLLNKKDMAFDNVNENSSP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SCN9A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57651.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Nav1.7 Recombinant Protein Antigen

  • ETHA
  • FEB3B
  • hNE-Na
  • Nav1.7
  • NENA
  • NE-NA
  • NENAVoltage-gated sodium channel subunit alpha Nav1.7
  • Neuroendocrine sodium channel
  • Peripheral sodium channel 1
  • PN1
  • PN1hNE-Na
  • SCN9A
  • sodium channel protein type 9 subunit alpha
  • Sodium channel protein type IX subunit alpha
  • sodium channel, voltage-gated, type IX, alpha subunit
  • voltage-gated sodium channel alpha subunit Nav1.7
  • voltage-gated, type IX, alpha polypeptide

Background

Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient. It is a tetrodotoxin-sensitive Na(+) channel isoform. Plays a role in pain mechanisms, especially in the development of inflammatory pain (from SwissProt).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47615
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, MiAr, WB
NBP2-84177
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-82600
Species: Hu
Applications: IHC,  IHC-P
NBP3-52336
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF,  IHC-P, IP, WB
NBP2-94560
Species: Hu
Applications: WB
H00006326-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NB600-804
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA
NBP2-30861
Species: Hu
Applications: ICC/IF
2980-PI
Species: Hu
Applications: InhibAct
AF6517
Species: Hu
Applications: WB
NB100-40840
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NB100-56490
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB
256-GF
Species: Hu
Applications: BA
NBP1-86072
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-97768
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
AF1056
Species: Rt
Applications: IHC, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP2-57651PEP
Species: Hu
Applications: AC

Publications for Nav1.7 Recombinant Protein Antigen (NBP2-57651PEP) (0)

There are no publications for Nav1.7 Recombinant Protein Antigen (NBP2-57651PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nav1.7 Recombinant Protein Antigen (NBP2-57651PEP) (0)

There are no reviews for Nav1.7 Recombinant Protein Antigen (NBP2-57651PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Nav1.7 Recombinant Protein Antigen (NBP2-57651PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Nav1.7 Products

Array NBP2-57651PEP

Research Areas for Nav1.7 Recombinant Protein Antigen (NBP2-57651PEP)

Find related products by research area.

Blogs on Nav1.7

There are no specific blogs for Nav1.7, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Nav1.7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SCN9A