Nav1.7 Antibody (5A11)

Images

 
Western Blot: Nav1.7 Antibody (5A11) [H00006335-M01] - detection against Immunogen (33.92 KDa).
Western Blot: Nav1.7 Antibody (5A11) [H00006335-M01] - SCN9A monoclonal antibody (M01), clone 5A11. Analysis of SCN9A expression in rat testis.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA
Clone
5A11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Nav1.7 Antibody (5A11) Summary

Immunogen
SCN9A (NP_002968 269 a.a. - 339 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GNLKHKCFRNSLENNETLESIMNTLESEEDFRKYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNPDY
Specificity
SCN9A (5A11)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SCN9A
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Nav1.7 Antibody (5A11)

  • ETHA
  • FEB3B
  • NE-NA
  • NENAVoltage-gated sodium channel subunit alpha Nav1.7
  • Neuroendocrine sodium channel
  • Peripheral sodium channel 1
  • PN1hNE-Na
  • sodium channel protein type 9 subunit alpha
  • Sodium channel protein type IX subunit alpha
  • sodium channel, voltage-gated, type IX, alpha subunit
  • voltage-gated sodium channel alpha subunit Nav1.7
  • voltage-gated, type IX, alpha polypeptide

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47615
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P
H00006334-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82600
Species: Hu
Applications: IHC, IHC-P
NBP2-58876
Species: Hu
Applications: ICC/IF
H00006328-M06
Species: Hu
Applications: WB, ELISA
H00006326-Q01
Species: Hu
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
H00006329-R01
Species: Hu
2980-PI
Species: Hu
AF6517
Species: Hu
Applications: WB
NB100-40840
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-56490
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-86072
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82268
Species: Hu
Applications: WB, IHC, IHC-P
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00006335-M01
Species: Hu, Rt
Applications: WB, ELISA

Publications for Nav1.7 Antibody (H00006335-M01) (0)

There are no publications for Nav1.7 Antibody (H00006335-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nav1.7 Antibody (H00006335-M01) (0)

There are no reviews for Nav1.7 Antibody (H00006335-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nav1.7 Antibody (H00006335-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nav1.7 Products

Bioinformatics Tool for Nav1.7 Antibody (H00006335-M01)

Discover related pathways, diseases and genes to Nav1.7 Antibody (H00006335-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nav1.7 Antibody (H00006335-M01)

Discover more about diseases related to Nav1.7 Antibody (H00006335-M01).
 

Pathways for Nav1.7 Antibody (H00006335-M01)

View related products by pathway.

PTMs for Nav1.7 Antibody (H00006335-M01)

Learn more about PTMs related to Nav1.7 Antibody (H00006335-M01).

Blogs on Nav1.7

There are no specific blogs for Nav1.7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nav1.7 Antibody (5A11) and receive a gift card or discount.

Bioinformatics

Gene Symbol SCN9A
Entrez
OMIM
Uniprot