Nav1.6 Antibody (4G7)

Images

 
Western Blot: Nav1.6 Antibody (4G7) [H00006334-M04] - Analysis against Immunogen (36.52 KDa).
Immunocytochemistry/ Immunofluorescence: Nav1.6 Antibody (4G7) [H00006334-M04] - Analysis of monoclonal antibody to SCN8A on NIH/3T3 cell. Antibody concentration 10 ug/ml
Western Blot: Nav1.6 Antibody (4G7) [H00006334-M04] - Analysis of SCN8A expression in NIH/3T3 ( Cat # L018V1 ).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4G7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Nav1.6 Antibody (4G7) Summary

Immunogen
SCN8A (NP_055006 1854 a.a. - 1951 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFICKKTTSNKLENGGTHREKKESTPSTASLPSYDSVT
Specificity
SCN8A (4G7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SCN8A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.
Publications
Read Publication using H00006334-M04.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Nav1.6 Antibody (4G7)

  • CerIII
  • hNa6/Scn8a voltage-gated sodium channel
  • MED
  • NaCh6
  • Nav1.6
  • PN4
  • sodium channel protein type 8 subunit alpha
  • Sodium channel protein type VIII subunit alpha
  • sodium channel, voltage gated, type VIII, alpha polypeptide
  • sodium channel, voltage gated, type VIII, alpha subunit
  • Voltage-gated sodium channel subunit alpha Nav1.6

Background

Voltage-dependent sodium channels, such as SCN8A, are responsible for the initial membrane depolarization that occurs during generation of action potentials in most electrically excitable cells (Plummer et al., 1998 [PubMed 9828131]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006326-Q01
Species: Hu
NBP2-58876
Species: Hu
Applications: ICC/IF
NB100-64779
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, IP
NBP2-12904
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC
H00006328-M06
Species: Hu
Applications: WB, ELISA
NBP1-47615
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77022
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-82600
Species: Hu
Applications: IHC, IHC-P
AF7548
Species: Hu
Applications: IHC
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00001836-M04
Species: Hu
Applications: WB, ELISA
H00006334-M04
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Nav1.6 Antibody (H00006334-M04)(1)

Reviews for Nav1.6 Antibody (H00006334-M04) (0)

There are no reviews for Nav1.6 Antibody (H00006334-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Nav1.6 Antibody (H00006334-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nav1.6 Products

Bioinformatics Tool for Nav1.6 Antibody (H00006334-M04)

Discover related pathways, diseases and genes to Nav1.6 Antibody (H00006334-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nav1.6 Antibody (H00006334-M04)

Discover more about diseases related to Nav1.6 Antibody (H00006334-M04).
 

Pathways for Nav1.6 Antibody (H00006334-M04)

View related products by pathway.

PTMs for Nav1.6 Antibody (H00006334-M04)

Learn more about PTMs related to Nav1.6 Antibody (H00006334-M04).

Blogs on Nav1.6

There are no specific blogs for Nav1.6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nav1.6 Antibody (4G7) and receive a gift card or discount.

Bioinformatics

Gene Symbol SCN8A
Entrez
OMIM
Uniprot