NAT1 Antibody [Alexa Fluor® 647]

Product Discontinued

NAT1 Antibody [Alexa Fluor® 647] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-290 of human NAT1 (NP_001153646.1).
  
  Sequence:
  MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYIVDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDLLEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NAT1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for NAT1 Antibody [Alexa Fluor® 647]

• AAC1N-acetyltransferase type 1
• Arylamide acetylase 1
• arylamine N-acetyltransferase 1
• EC 2.3.1.5
• MNAT
• Monomorphic arylamine N-acetyltransferase
• N-acetyltransferase 1 (arylamine N-acetyltransferase)
• NAT-1
• NATI

Background

NAT1 is a gene that codes for a protein that helps in the detoxification of various hydrazine and arylamine drugs as well as to bioactivate several carcinogens and is 290 amino acids long with a weight of approximately 34 kDa. Current studies are being done on several diseases and disorders related to this gene including neural tube defect, drug-induced hepatitis, talipes equinovarus, spina bifida, multiple chemical sensitivity, malignant pleural mesothelioma, non-Hodgkin lymphoma, cleft palate, familial adenomatous polyposis, substance abuse, orofacial cleft, peptic ulcer, lymphoblastic leukemia, systemic lupus erythematosus, cystic fibrosis, lupus erythematosus, Hodgkin's lymphoma, inflammatory bowel disease, and motor neuron disease. NAT1 has also been shown to have interactions with NAA10, SNTA1, SYP1A2, CYP2A6, and XDH in pathways such as the arylamine metabolism, acetylation, and drug metabolism pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NAT1