Napsin A Recombinant Protein Antigen

Images

 
There are currently no images for Napsin A Recombinant Protein Antigen (NBP2-34213PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Napsin A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NAPSA.

Source: E.coli

Amino Acid Sequence: SDPAHYIPPLTFVPVTVPAYWQIHMERVKVG

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NAPSA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-34213.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Napsin A Recombinant Protein Antigen

  • Asp 4
  • ASP4
  • Aspartyl protease 4
  • EC 3.4.23
  • EC 3.4.23.-
  • EC 3.4.23.15
  • EC 3.4.23.3
  • EC 3.4.23.5
  • KAP
  • Kdap
  • NAP1napsin-A
  • NAPA
  • NAPApronapsin A
  • NAPSA
  • napsin A aspartic peptidase
  • Napsin A
  • Napsin-1
  • SNAPA
  • TA01/TA02

Background

Napsin is a pepsin-like aspartic proteinase, in the A1 clan of the AA clade of proteinases. Other AA family proteinases include Pepsin, cathepsin-D, cathepsin-E and rennin. Of these proteinases, napsin is most closely related to cathepsin-D, sharing 46% identity at the amino acid level. There are two closely related Napsins, napsin A and napsin B, with 85% overall identity at the amino acid level. There are three isoforms. Napsin-A is also termed napsin-1, or TA02, a Tumor Adenocarcinoma marker. Napsin A may be involved in processing of pneumocyte surfactant precursors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-17155
Species: Hu
Applications: IHC, IHC-P
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
NBP3-13180
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-37252
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-01763
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-47659
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-23368
Species: Hu
Applications: PAGE
H00002038-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
H00010097-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP1-81162
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF1444
Species: Mu
Applications: IHC, WB
NBP1-30955
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38740
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-01245
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-03514
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-07996
Species: Hu
Applications: WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB

Publications for Napsin A Recombinant Protein Antigen (NBP2-34213PEP) (0)

There are no publications for Napsin A Recombinant Protein Antigen (NBP2-34213PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Napsin A Recombinant Protein Antigen (NBP2-34213PEP) (0)

There are no reviews for Napsin A Recombinant Protein Antigen (NBP2-34213PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Napsin A Recombinant Protein Antigen (NBP2-34213PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Napsin A Products

Bioinformatics Tool for Napsin A Recombinant Protein Antigen (NBP2-34213PEP)

Discover related pathways, diseases and genes to Napsin A Recombinant Protein Antigen (NBP2-34213PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Napsin A Recombinant Protein Antigen (NBP2-34213PEP)

Discover more about diseases related to Napsin A Recombinant Protein Antigen (NBP2-34213PEP).
 

Pathways for Napsin A Recombinant Protein Antigen (NBP2-34213PEP)

View related products by pathway.

PTMs for Napsin A Recombinant Protein Antigen (NBP2-34213PEP)

Learn more about PTMs related to Napsin A Recombinant Protein Antigen (NBP2-34213PEP).
 

Research Areas for Napsin A Recombinant Protein Antigen (NBP2-34213PEP)

Find related products by research area.

Blogs on Napsin A

There are no specific blogs for Napsin A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Napsin A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NAPSA