Napsin A Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Napsin A Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NAPSA.
  
  

  Source: E.coli

  Amino Acid Sequence: SDPAHYIPPLTFVPVTVPAYWQIHMERVKVG

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: NAPSA
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This peptide is useful as a blocking peptide for NBP2-34213.
  Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.
  
  For further blocking peptide related information and a protocol, click here.
• Theoretical MW: 21 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Napsin A Recombinant Protein Antigen

• Asp 4
• ASP4
• Aspartyl protease 4
• EC 3.4.23
• EC 3.4.23.-
• EC 3.4.23.15
• EC 3.4.23.3
• EC 3.4.23.5
• KAP
• Kdap
• NAP1napsin-A
• NAPA
• NAPApronapsin A
• NAPSA
• napsin A aspartic peptidase
• Napsin A
• Napsin-1
• SNAPA
• TA01/TA02

Background

Napsin is a pepsin-like aspartic proteinase, in the A1 clan of the AA clade of proteinases. Other AA family proteinases include Pepsin, cathepsin-D, cathepsin-E and rennin. Of these proteinases, napsin is most closely related to cathepsin-D, sharing 46% identity at the amino acid level. There are two closely related Napsins, napsin A and napsin B, with 85% overall identity at the amino acid level. There are three isoforms. Napsin-A is also termed napsin-1, or TA02, a Tumor Adenocarcinoma marker. Napsin A may be involved in processing of pneumocyte surfactant precursors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NAPSA