NAP1L5 Antibody

Images

 
Western Blot: NAP1L5 Antibody [NBP2-83255] - WB Suggested Anti-Nap1l5 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Small Intestine

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NAP1L5 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of NAP1L5. Peptide sequence: GDSAAAPAAEEPQAPAENAPKPKKDFMESLPNSVKCRVLALKKLQKRCDK The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
NAP1L5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NAP1L5 Antibody

  • down-regulated in liver malignancy
  • DRLM1110020M21Rik
  • nucleosome assembly protein 1-like 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-55228
Species: Hu
Applications: IHC, IHC-P, WB
H00055607-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-87299
Species: Hu
Applications: ICC/IF, WB
NBP2-46379
Species: Hu
Applications: IHC, WB
NB100-86989
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
AF2228
Species: Hu
Applications: ICC, IHC, WB
NBP2-92868
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81553
Species: Hu, Rt
Applications: IHC, IHC-P, WB
H00004826-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-92389
Species: Hu
Applications: IHC, IHC-P, WB
AF4679
Species: Hu
Applications: WB
247-ILB/CF
Species: Hu
Applications: BA
NBP2-52540
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-14290
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90105
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-55735
Species: Bv, Ca, Ch, Hu, Mu, Pm
Applications: ICC/IF, IP, WB

Publications for NAP1L5 Antibody (NBP2-83255) (0)

There are no publications for NAP1L5 Antibody (NBP2-83255).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAP1L5 Antibody (NBP2-83255) (0)

There are no reviews for NAP1L5 Antibody (NBP2-83255). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NAP1L5 Antibody (NBP2-83255) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NAP1L5 Products

Bioinformatics Tool for NAP1L5 Antibody (NBP2-83255)

Discover related pathways, diseases and genes to NAP1L5 Antibody (NBP2-83255). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NAP1L5 Antibody (NBP2-83255)

Discover more about diseases related to NAP1L5 Antibody (NBP2-83255).
 

Pathways for NAP1L5 Antibody (NBP2-83255)

View related products by pathway.

PTMs for NAP1L5 Antibody (NBP2-83255)

Learn more about PTMs related to NAP1L5 Antibody (NBP2-83255).
 

Research Areas for NAP1L5 Antibody (NBP2-83255)

Find related products by research area.

Blogs on NAP1L5

There are no specific blogs for NAP1L5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NAP1L5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAP1L5