NAP1L1 Antibody (4W8B6) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NAP1L1 (P55209). MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVH |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
NAP1L1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for NAP1L1 Antibody (4W8B6)
Background
NAP1L1 encodes a member of the nucleosome assembly protein (NAP) family. This protein participates in DNA replication and may play a role in modulating chromatin formation and contribute to the regulation of cell proliferation. Alternative splicing of this gene results in several transcript variants; however, not all have been fully described. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu, Rt
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: ELISA
Species: Mu, Rt
Applications: Block, IHC, Simple Western, WB
Species: Hu, Rt
Applications: IHC, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Publications for NAP1L1 Antibody (NBP3-16633) (0)
There are no publications for NAP1L1 Antibody (NBP3-16633).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NAP1L1 Antibody (NBP3-16633) (0)
There are no reviews for NAP1L1 Antibody (NBP3-16633).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NAP1L1 Antibody (NBP3-16633) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NAP1L1 Products
Research Areas for NAP1L1 Antibody (NBP3-16633)
Find related products by research area.
|
Blogs on NAP1L1