![Immunohistochemistry-Paraffin: NAALADase-like 1/NAALADL1 Antibody [NBP2-14584] - Staining of human small intestine shows high expression.](http://images.novusbio.com/fullsize/NAALADase-like-1-NAALADL1-Antibody-Immunohistochemistry-Paraffin-NBP2-14584-img0003.jpg "Immunohistochemistry-Paraffin: NAALADase-like 1/NAALADL1 Antibody [NBP2-14584] - Staining of human small intestine shows high expression.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: RLSDSFFLPLKVSDYSETLRSFLQAAQQDLGALLEQHSISLGPLVTAVEKFEAEAAALGQRISTLQKGSPDPLQVRMLN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NAALADL1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot NAALADase-2/NAALAD2 Antibody (756030) [Unconjugated]](https://images.novusbio.com/images2/12514.jpg)
![Immunohistochemistry NAALADase-2/NAALAD2 Antibody (756030) [Unconjugated]](https://images.novusbio.com/images2/12521.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NAALADL1 |
![Immunohistochemistry-Paraffin: NAALADase-like 1/NAALADL1 Antibody [NBP2-14584] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/NAALADase-like-1-NAALADL1-Antibody-Immunohistochemistry-Paraffin-NBP2-14584-img0002.jpg "Immunohistochemistry-Paraffin: NAALADase-like 1/NAALADL1 Antibody [NBP2-14584] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: NAALADase-like 1/NAALADL1 Antibody [NBP2-14584] - Staining in human small intestine and pancreas tissues using anti-NAALADL1 antibody. Corresponding NAALADL1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/NAALADase-like-1-NAALADL1-Antibody-Immunohistochemistry-Paraffin-NBP2-14584-img0004.jpg "Immunohistochemistry-Paraffin: NAALADase-like 1/NAALADL1 Antibody [NBP2-14584] - Staining in human small intestine and pancreas tissues using anti-NAALADL1 antibody. Corresponding NAALADL1 RNA-seq data are presented for the same tissues.")
![Simple Western DPPIV/CD26 Antibody [Unconjugated]](https://images.novusbio.com/images2/DPPIV_AF1180_Simple_Western_20720.jpg)
![Immunohistochemistry DPPIV/CD26 Antibody [Unconjugated]](https://images.novusbio.com/images2/DPPIV_AF1180_Immunohistochemistry_17209.jpg)
![Immunocytochemistry DPPIV/CD26 Antibody [Unconjugated]](https://images.novusbio.com/images2/DPPIV_AF1180_Immunocytochemistry__Immunofluorescence_17210.jpg)
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![Western Blot CISH/CIS-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/CIS-1_AF3194_Western_Blot_5249.jpg)
![Immunocytochemistry CISH/CIS-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/af3194_human-cis-1-affinity-purified-polyclonal-ab-immunocytochemistry-309202194844.jpg)
![Simple Western CISH/CIS-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/af3194_human-cis-1-affinity-purified-polyclonal-ab-simple-western-1342022124434.jpg)
![DAN/NBL1 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "DAN/NBL1 Antibody [Unconjugated]")
![SEC-MALS IL-15 [Unconjugated]](https://images.novusbio.com/images/247-ilb_recombinant-human-il-15-protein-sec-mals-2922024964..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")