NAA11 Antibody

Images

 
Western Blot: NAA11 Antibody [NBP1-91327] - Rat Lung Lysate 1.0 ug/ml, gel concentration 12%

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ye, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NAA11 Antibody Summary

Immunogen
The specific Immunogen is proprietary information. Peptide sequence SAKYVSLHVRKSNRAALHLYSNTLNFQVSEVEPKYYADGEDAYAMKRDLA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NAA11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Ard1b and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NAA11 Antibody

  • ARD1 homolog B
  • ARD1B
  • ARD2
  • hARD2
  • human arrest defective 2
  • MGC10646
  • N(alpha)-acetyltransferase 11, NatA catalytic subunit
  • NatA catalytic subunit
  • N-terminal acetyltransferase complex ARD1 subunit homolog B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33934
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-129
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-58144
Species: Hu, Mu, Rt, Bv, Eq, GP, Rb
Applications: WB, IHC, IHC-P
NBP1-21387
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-86479
Species: Hu
Applications: IHC, IHC-P
NBP2-15299
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
24790002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ca, Ft, Mk, Pm, Rb, Sh, Xp
Applications: WB, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, TCS, KO, LA
NBP1-85311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-85899
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-60103
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb, Sh
Applications: WB, IHC
NBP1-81010
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-78620
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-60120
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB, TCS
NBP1-31004
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90113
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for NAA11 Antibody (NBP1-91327) (0)

There are no publications for NAA11 Antibody (NBP1-91327).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAA11 Antibody (NBP1-91327) (0)

There are no reviews for NAA11 Antibody (NBP1-91327). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NAA11 Antibody (NBP1-91327) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NAA11 Products

Bioinformatics Tool for NAA11 Antibody (NBP1-91327)

Discover related pathways, diseases and genes to NAA11 Antibody (NBP1-91327). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NAA11 Antibody (NBP1-91327)

Discover more about diseases related to NAA11 Antibody (NBP1-91327).
 

Pathways for NAA11 Antibody (NBP1-91327)

View related products by pathway.

PTMs for NAA11 Antibody (NBP1-91327)

Learn more about PTMs related to NAA11 Antibody (NBP1-91327).

Blogs on NAA11

There are no specific blogs for NAA11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NAA11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAA11
Uniprot