MYST1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MYST1 Antibody [NBP2-56864] - Staining of human cell line MCF7 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MYST1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHE
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KAT8
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MYST1 Recombinant Protein Antigen (NBP2-56864PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MYST1 Antibody

  • FLJ14040
  • hMOFhistone acetyltransferase MYST1
  • KAT8
  • MOFEC 2.3.1.48
  • MOZ, YBF2/SAS3, SAS2 and TIP60 protein 1
  • MYST histone acetyltransferase 1
  • MYST-1
  • ortholog of Drosophila males absent on the first (MOF)
  • probable histone acetyltransferase MYST1

Background

The MYST family of histone acetyltransferases, which includes MYST1, is named for the founding members MOZ (MYST3; MIM 601408), yeast YBF2 and SAS2, and TIP60 (HTATIP; MIM 601409). All members of this family contain a MYST region of about 240 amino acids with a canonical acetyl-CoA-binding site and a C2HC-type zinc finger motif. Most MYST proteins also have a chromodomain involved in protein-protein interactions and targeting transcriptional regulators to chromatin (Neal et al., 2000).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

210-TA
Species: Hu
Applications: BA
NBP2-07996
Species: Hu
Applications: WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
D6050
Species: Hu
Applications: ELISA
H00008294-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
H00008363-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00008362-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
NBL1-11567
Species: Hu
Applications: WB
NB21-2024
Species: Hu, Ma, Mu, Po, Rt
Applications: ChIP, DB, ICC/IF, WB
NBP2-24613
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NBP1-83853
Species: Hu, Mu
Applications: ChIP, IP, WB
NBP1-92161
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
2695-SE
Species: Hu
Applications: EnzAct
NBP1-51641
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB
DY417
Species: Mu
Applications: ELISA
H00007994-M07
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
AF1936
Species: Hu
Applications: IP, WB

Publications for MYST1 Antibody (NBP2-56864) (0)

There are no publications for MYST1 Antibody (NBP2-56864).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYST1 Antibody (NBP2-56864) (0)

There are no reviews for MYST1 Antibody (NBP2-56864). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MYST1 Antibody (NBP2-56864) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MYST1 Products

Bioinformatics Tool for MYST1 Antibody (NBP2-56864)

Discover related pathways, diseases and genes to MYST1 Antibody (NBP2-56864). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYST1 Antibody (NBP2-56864)

Discover more about diseases related to MYST1 Antibody (NBP2-56864).
 

Pathways for MYST1 Antibody (NBP2-56864)

View related products by pathway.

PTMs for MYST1 Antibody (NBP2-56864)

Learn more about PTMs related to MYST1 Antibody (NBP2-56864).
 

Research Areas for MYST1 Antibody (NBP2-56864)

Find related products by research area.

Blogs on MYST1

There are no specific blogs for MYST1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MYST1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KAT8