Myotubularin Related Protein 10 Antibody

Images

 
Western Blot: Myotubularin Related Protein 10 Antibody [NBP2-83246] - Host: Rabbit. Target Name: MTMR10. Sample Tissue: Human Jurkat Whole Cell. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Myotubularin Related Protein 10 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human Myotubularin Related Protein 10. Peptide sequence: KNGIISDQELLPRRNSLILKPKPDPAQQTDSQNSDTEQYFREWFSKPANL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
MTMR10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Myotubularin Related Protein 10 Antibody

  • MTMR10
  • Myotubularin-Related Protein 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58415
Species: Hu
Applications: IHC, IHC-P
NBP1-88434
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80090
Species: Hu
Applications: WB
NBP1-52375
Species: Bv, Ca, Ch, Eq, Hu, Pm, Po
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-42677
Species: Hu
Applications: IHC, IHC-P, IP, WB
H00051621-M01
Species: Hu, Mu, Rt
Applications: ELISA, WB
H00004948-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-94530
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP3-05582
Species: Hu
Applications: ICC/IF, IF, WB
NBP1-86113
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37477
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for Myotubularin Related Protein 10 Antibody (NBP2-83246) (0)

There are no publications for Myotubularin Related Protein 10 Antibody (NBP2-83246).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myotubularin Related Protein 10 Antibody (NBP2-83246) (0)

There are no reviews for Myotubularin Related Protein 10 Antibody (NBP2-83246). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Myotubularin Related Protein 10 Antibody (NBP2-83246) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Myotubularin Related Protein 10 Products

Bioinformatics Tool for Myotubularin Related Protein 10 Antibody (NBP2-83246)

Discover related pathways, diseases and genes to Myotubularin Related Protein 10 Antibody (NBP2-83246). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myotubularin Related Protein 10 Antibody (NBP2-83246)

Discover more about diseases related to Myotubularin Related Protein 10 Antibody (NBP2-83246).
 

Pathways for Myotubularin Related Protein 10 Antibody (NBP2-83246)

View related products by pathway.

Blogs on Myotubularin Related Protein 10

There are no specific blogs for Myotubularin Related Protein 10, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myotubularin Related Protein 10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MTMR10