Recombinant Human Myosin light chain 3 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Myosin light chain 3 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 34-106 of Human Myosin light chain 3

Source: Wheat Germ

Amino Acid Sequence: EVEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPRQEELNT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MYL3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
33.77 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Myosin light chain 3 Protein

  • Cardiac myosin light chain 1
  • CMH8Ventricular/slow twitch myosin alkali light chain
  • CMLC1
  • light polypeptide 3, alkali; ventricular, skeletal, slow
  • MLC1SBMyosin light chain 1, slow-twitch muscle B/ventricular isoform
  • MLC1V
  • myosin light chain 3
  • myosin, light chain 3, alkali; ventricular, skeletal, slow
  • VLC1

Background

MYL3 encodes myosin light chain 3, an alkali light chain also referred to in the literature as both the ventricular isoform and the slow skeletal muscle isoform. Mutations in MYL3 have been identified as a cause of mid-left ventricular chamber type hypertrophic cardiomyopathy. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16433
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-30249
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, Flow, ICC/IF
NB110-2546
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Fi, Gt, Rb
Applications: WB, ChIP, Flow, IA, ICC/IF, IHC, IHC-P, IP, S-ELISA
MAB9096
Species: Hu
Applications: WB, IHC
NBP1-33716
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P
NBP1-80073
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-33759
Species: Mu
Applications: WB, IHC, IHC-P
AF7439
Species: Hu
Applications: WB, IHC
NBP2-30954
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-55151
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
H00004634-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Myosin light chain 3 Partial Recombinant Protein (H00004634-Q01) (0)

There are no publications for Myosin light chain 3 Partial Recombinant Protein (H00004634-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myosin light chain 3 Partial Recombinant Protein (H00004634-Q01) (0)

There are no reviews for Myosin light chain 3 Partial Recombinant Protein (H00004634-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Myosin light chain 3 Partial Recombinant Protein (H00004634-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Myosin light chain 3 Products

Bioinformatics Tool for Myosin light chain 3 Partial Recombinant Protein (H00004634-Q01)

Discover related pathways, diseases and genes to Myosin light chain 3 Partial Recombinant Protein (H00004634-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myosin light chain 3 Partial Recombinant Protein (H00004634-Q01)

Discover more about diseases related to Myosin light chain 3 Partial Recombinant Protein (H00004634-Q01).
 

Pathways for Myosin light chain 3 Partial Recombinant Protein (H00004634-Q01)

View related products by pathway.

Blogs on Myosin light chain 3

There are no specific blogs for Myosin light chain 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Myosin light chain 3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MYL3