MYO9B Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

MYO9B Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MYO9B.
  
  

  Source: E. coli

  Amino Acid Sequence: TDGERSAKKPAVQKKKPGDASSLPDAGLSPGSQVDSKSTFKRLFLHKTKDKKYSLEGAEELENAVSGHVVLEATTM

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: MYO9B
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84548.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MYO9B Recombinant Protein Antigen

• CELIAC4
• myosin IXB
• myosin-IXb
• MYR5Unconventional myosin-9b
• unconventional myosin IXb

Background

Myosin IX belongs to the family of unconventional myosins, distinct from the classical myosins I and myosins II. Myosin IX, thought to be involved in signal transduction and leukocyte differentiation, includes several isoforms. The rat isoforms are myosin IX/Myr5 (230 kDa) and Myr7 (300 kDa), and the human isoforms are myosin IXa (MYO9A) and myosin IXb (MYO9B). The isoforms of myosin IX have similar overall domain structure and are expressed in many tissues and cell types, although they have distinct tissue expression patterns. The subcellular localization of class IX myosins appears to be partly cytoplasmic, and partly associated with membranes and the actin cytoskeleton. The expression level of myosins IX may vary during development and differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: MYO9B