Recombinant Human MYO9B GST (N-Term) Protein Summary
| Description |
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 201-290 of Human MYO9B Source: Wheat Germ (in vitro) Amino Acid Sequence: CPDNSDPLTSMKDVLKITTCVEMLIKEQMRKYKVKMEEISQLEAAESIAFRRLSLLRQNAPWPLKLGFSSPYEGVLNKSPKTRDIQEEEL |
Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source |
Wheat germ |
| Protein/Peptide Type |
Recombinant Protein |
| Gene |
MYO9B |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- SDS-Page
- Western Blot
|
| Theoretical MW |
35.64 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human MYO9B GST (N-Term) Protein
Background
Myosin IX belongs to the family of unconventional myosins, distinct from the classical myosins I and myosins II. Myosin IX, thought to be involved in signal transduction and leukocyte differentiation, includes several isoforms. The rat isoforms are myosin IX/Myr5 (230 kDa) and Myr7 (300 kDa), and the human isoforms are myosin IXa (MYO9A) and myosin IXb (MYO9B). The isoforms of myosin IX have similar overall domain structure and are expressed in many tissues and cell types, although they have distinct tissue expression patterns. The subcellular localization of class IX myosins appears to be partly cytoplasmic, and partly associated with membranes and the actin cytoskeleton. The expression level of myosins IX may vary during development and differentiation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Pm, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: All-Multi
Applications: Flow, ICC, IHC, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, Neut, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: Neut, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, KD, WB
Publications for MYO9B Partial Recombinant Protein (H00004650-Q01) (0)
There are no publications for MYO9B Partial Recombinant Protein (H00004650-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MYO9B Partial Recombinant Protein (H00004650-Q01) (0)
There are no reviews for MYO9B Partial Recombinant Protein (H00004650-Q01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MYO9B Partial Recombinant Protein (H00004650-Q01) (0)
Additional MYO9B Products
Research Areas for MYO9B Partial Recombinant Protein (H00004650-Q01)
Find related products by research area.
|
Blogs on MYO9B