We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

MYO18A Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related MYO18A Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-83020PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MYO18A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MYO18A.

Source: E. coli

Amino Acid Sequence: RFSFSQRSRDESASETSTPSEHSAAPSPQVEVRTLEGQLVQHPGPGIPRPGHRSRAPELVTKKFPVDLRLPPVVPLPPPTLRELELQRRPTGDFGFSLRRTTMLDRGPEGQACRRVVHFAEP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MYO18A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83020.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MYO18A Recombinant Protein Antigen

  • KIAA0216DKFZp686L0243
  • MAJN
  • Molecule associated with JAK3 N-terminus
  • myosin 18A
  • Myosin containing a PDZ domain
  • myosin containing PDZ domain
  • myosin XVIIIA
  • myosin-XVIIIa
  • MysPDZ
  • SP-A receptor subunit SP-R210 alphaS
  • SPR210

Background

Myo18A/Myosin XVIIIA is an unconventional myosin that contains a lysine and glutamine (KE)-rich domain and a PDZ domain. The KE and PDZ domains appear to direct subcellular localization of the Myo18A variants. It is a dimeric actin binding protein that may play a role in the stabilization and organization of the actin cytoskeleton. Recently a cell surface form of Myo18A has been identified as the receptor for surfactant protein A, a lipid-associated lung collectin that mediates innate and adaptive immune responses in the lungs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-43363
Species: Mu
Applications: B/N, Flow, IHC, IHC-Fr,  IHC-P, WB
NBP1-84796
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
MAB4470
Species: All-Multi
Applications: Flow, ICC, IHC, WB
NBP2-75515
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF,  IHC-P, WB
NBP1-87466
Species: Hu
Applications: IHC,  IHC-P
NB100-74648
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF7548
Species: Hu
Applications: IHC
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-05161
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-82022
Species: Hu, Mu
Applications: ELISA, ICC, ICC/IF, WB
NB300-829
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA
202-IL
Species: Hu
Applications: BA
AF2377
Species: Mu
Applications: IHC, Simple Western, WB
NBP2-61707
Species: Hu
Applications: ELISA, Flow, WB
NB600-1287
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-83020PEP
Species: Hu
Applications: AC

Publications for MYO18A Protein (NBP1-83020PEP) (0)

There are no publications for MYO18A Protein (NBP1-83020PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYO18A Protein (NBP1-83020PEP) (0)

There are no reviews for MYO18A Protein (NBP1-83020PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MYO18A Protein (NBP1-83020PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MYO18A Products

Array NBP1-83020PEP

Research Areas for MYO18A Protein (NBP1-83020PEP)

Find related products by research area.

Blogs on MYO18A

There are no specific blogs for MYO18A, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MYO18A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MYO18A