MYEOV Recombinant Protein Antigen

Images

 
There are currently no images for MYEOV Protein (NBP1-80974PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MYEOV Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MYEOV.

Source: E.coli

Amino Acid Sequence: TPALPIGLCTRCCLCLEQSPSWCHCLRGVSFLTFHLHQSVPLGDRDSLLMFTRQAGHFVEGSKAGRSRGRLCLSQALRVAVRGAFVSLWFAAGAGDRERNKGDKGAQTGAGLSQEAEDVDVSRARRVTDAPQGTLCGTGN

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MYEOV
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-80974.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for MYEOV Recombinant Protein Antigen

  • myeloma overexpressed (in a subset of t(11;14) positive multiple myelomas)
  • myeloma overexpressed gene (in a subset of t(11;14) positive multiple myelomas)
  • OCIMhypothetical protein LOC26579
  • Oncogene in multiple myeloma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
7460-F4/CF
Species: Hu
Applications: BA
NBP2-67632
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-46527
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
1206-F3/CF
Species: Hu
Applications: BA
NBP1-30670
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-12913
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
DF1900
Species: Hu
Applications: ELISA
MAB6978
Species: Hu, Mu, Rt
Applications: WB
NBP2-24551
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-93677
Species: Hu, Mu, Rt
Applications: WB
NBP3-13225
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-13174
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-122
Species: Fi, Ha, Hu, Mu, Pm, Rb, Rt, Re, Sh
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, PAGE, Simple Western, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-83116
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00001491-M01
Species: Gp, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-90105
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82953
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80974PEP
Species: Hu
Applications: AC

Publications for MYEOV Protein (NBP1-80974PEP) (0)

There are no publications for MYEOV Protein (NBP1-80974PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYEOV Protein (NBP1-80974PEP) (0)

There are no reviews for MYEOV Protein (NBP1-80974PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MYEOV Protein (NBP1-80974PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MYEOV Products

Array NBP1-80974PEP

Bioinformatics Tool for MYEOV Protein (NBP1-80974PEP)

Discover related pathways, diseases and genes to MYEOV Protein (NBP1-80974PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYEOV Protein (NBP1-80974PEP)

Discover more about diseases related to MYEOV Protein (NBP1-80974PEP).
 

Pathways for MYEOV Protein (NBP1-80974PEP)

View related products by pathway.

PTMs for MYEOV Protein (NBP1-80974PEP)

Learn more about PTMs related to MYEOV Protein (NBP1-80974PEP).

Blogs on MYEOV

There are no specific blogs for MYEOV, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MYEOV Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MYEOV