MxA/Mx1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MEEIFQHLMAYHQEASKRISSHIPLIIQFFMLQTYGQQLQKAMLQLLQDKDTYSWLLKERSDTSDKRKFLK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MX1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for MxA/Mx1 Antibody - BSA Free
Background
In mouse, the interferon-inducible Mx protein is responsible for a specific antiviral state against influenza virus infection. The protein encoded by this gene is similar to the mouse protein as determined by its antigenic relatedness, induction conditions, physicochemical properties, and amino acid analysis. This cytoplasmic protein is a member of both the dynamin family and the family of large GTPases. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Simple Western, WB
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: BA
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IP
Species: Ca, Hu, Mu
Applications: BA, B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: WB
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: BA, DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: WB
Publications for MxA/Mx1 Antibody (NBP2-56175) (0)
There are no publications for MxA/Mx1 Antibody (NBP2-56175).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MxA/Mx1 Antibody (NBP2-56175) (0)
There are no reviews for MxA/Mx1 Antibody (NBP2-56175).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MxA/Mx1 Antibody (NBP2-56175) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MxA/Mx1 Products
Research Areas for MxA/Mx1 Antibody (NBP2-56175)
Find related products by research area.
|
Blogs on MxA/Mx1