MxA/Mx1 Antibody

Images

 
Orthogonal Strategies: Western Blot: MxA/Mx1 Antibody [NBP2-56175] - Analysis in human cell lines SK-MEL-30 and U-251MG. Corresponding RNA-seq data are presented for the same cell lines. Loading control: ...read more
Immunocytochemistry/ Immunofluorescence: MxA/Mx1 Antibody [NBP2-56175] - Staining of human cell line U-2 OS shows localization to nuclear membrane & cytosol. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

MxA/Mx1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MEEIFQHLMAYHQEASKRISSHIPLIIQFFMLQTYGQQLQKAMLQLLQDKDTYSWLLKERSDTSDKRKFLK
Specificity
Specificity of human MxA/Mx1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MX1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MxA/Mx1 Recombinant Protein Antigen (NBP2-56175PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MxA/Mx1 Antibody

  • human interferon-regulated resistance GTP-binding protein MXA10IFI-78Khomolog of murine (interferon-inducibleprotein p78)
  • IFI78
  • IFI-78K
  • Mx1
  • MxA
  • myxovirus (influenza virus) resistance 1, interferon-inducible protein p78(mouse)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75930
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
AF8519
Species: Hu, Mu, Rt
Applications: WB
NBP1-81018
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-67691
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, BA, B/N, Flow-IC
H00064093-M03
Species: Hu, Ze
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-67634
Species: Hu, Mu, Rt, Fi, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-02340
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24906
Species: Hu, Mu, Rt
Applications: WB, DB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, BA, Flow-IC
NBP2-16991
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for MxA/Mx1 Antibody (NBP2-56175) (0)

There are no publications for MxA/Mx1 Antibody (NBP2-56175).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MxA/Mx1 Antibody (NBP2-56175) (0)

There are no reviews for MxA/Mx1 Antibody (NBP2-56175). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MxA/Mx1 Antibody (NBP2-56175) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MxA/Mx1 Products

Bioinformatics Tool for MxA/Mx1 Antibody (NBP2-56175)

Discover related pathways, diseases and genes to MxA/Mx1 Antibody (NBP2-56175). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MxA/Mx1 Antibody (NBP2-56175)

Discover more about diseases related to MxA/Mx1 Antibody (NBP2-56175).
 

Pathways for MxA/Mx1 Antibody (NBP2-56175)

View related products by pathway.

PTMs for MxA/Mx1 Antibody (NBP2-56175)

Learn more about PTMs related to MxA/Mx1 Antibody (NBP2-56175).
 

Research Areas for MxA/Mx1 Antibody (NBP2-56175)

Find related products by research area.

Blogs on MxA/Mx1

There are no specific blogs for MxA/Mx1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MxA/Mx1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MX1