mtRNA polymerase Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: mtRNA polymerase Antibody [NBP3-35578] - Immunofluorescence analysis of U-2 OS cells using mtRNA polymerase Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Western Blot: mtRNA polymerase Antibody [NBP3-35578] - Western blot analysis of various lysates using mtRNA polymerase Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.

Immunoprecipitation: mtRNA polymerase Antibody [NBP3-35578] - Immunoprecipitation analysis of 200 ug extracts of HepG2 cells, using 3 ug mtRNA polymerase antibody. Western blot was performed from the immunoprecipitate using mtRNA polymerase antibody at a dilution of 1:1000.

Immunocytochemistry/ Immunofluorescence: mtRNA polymerase Antibody [NBP3-35578] - Immunofluorescence analysis of C6 cells using mtRNA polymerase Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Rt
• Applications: WB, ELISA, ICC/IF, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

mtRNA polymerase Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit mtRNA polymerase Antibody - BSA Free (NBP3-35578) is a polyclonal antibody validated for use in WB, ELISA, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 42-230 of human mtRNA polymerase (NP_005026.3).
  
  Sequence:
  SSASPQEQDQDRRKDWGHVELLEVLQARVRQLQAESVSEVVVNRVDVARLPECGSGDGSLQPPRKVQMGAKDATPVPCGRWAKILEKDKRTQQMRMQRLKAKLQMPFQSGEFKALTRRLQVEPRLLSKQMAGCLEDCTRQAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POLRMT
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 139 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for mtRNA polymerase Antibody - BSA Free

• APOLMTEC 2.7.7.6
• DNA-directed RNA polymerase, mitochondrial
• EC 2.7.7.6
• h-mtRPOL
• mtRNA polymerase
• MTRNAP
• MtRPOL
• POLRMT
• polymerase (RNA) mitochondrial (DNA directed)

Background

POLRMT, also known as DNA-directed RNA polymerase, mitochondrial, is a 246 amino acid protein that is 28 kDa, catalyzes the transcription of mitochondrial DNA into RNA using the four ribonucleoside triphosphates as substrates. This protein is currently being studied for research on autosomal dominant progressive external ophthalmoplegia, essential thrombocythemia, ophthalmoplegia, immunodeficiency, and malaria. This protein has also shown to have interactions with TFB1M, NFKB2, ICT1, TFB2M, TFAM, and over 200 other proteins in ATP/ITP metabolism, mitochondrial gene expression, transcription from mitochondrial promoters, transcription, RNA polymerase I, RNA polymerase III, and mitochondrial transcription, gene expression, and mitochondrial transcription initiation pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: POLRMT