mtRNA polymerase Antibody - BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 42-230 of human mtRNA polymerase (NP_005026.3).
Sequence: SSASPQEQDQDRRKDWGHVELLEVLQARVRQLQAESVSEVVVNRVDVARLPECGSGDGSLQPPRKVQMGAKDATPVPCGRWAKILEKDKRTQQMRMQRLKAKLQMPFQSGEFKALTRRLQVEPRLLSKQMAGCLEDCTRQAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFF |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
POLRMT |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells
- Western Blot 1:500 - 1:2000
|
| Theoretical MW |
139 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for mtRNA polymerase Antibody - BSA Free
Background
POLRMT, also known as DNA-directed RNA polymerase, mitochondrial, is a 246 amino acid protein that is 28 kDa, catalyzes the transcription of mitochondrial DNA into RNA using the four ribonucleoside triphosphates as substrates. This protein is currently being studied for research on autosomal dominant progressive external ophthalmoplegia, essential thrombocythemia, ophthalmoplegia, immunodeficiency, and malaria. This protein has also shown to have interactions with TFB1M, NFKB2, ICT1, TFB2M, TFAM, and over 200 other proteins in ATP/ITP metabolism, mitochondrial gene expression, transcription from mitochondrial promoters, transcription, RNA polymerase I, RNA polymerase III, and mitochondrial transcription, gene expression, and mitochondrial transcription initiation pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu(-)
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Publications for mtRNA polymerase Antibody (NBP3-35578) (0)
There are no publications for mtRNA polymerase Antibody (NBP3-35578).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for mtRNA polymerase Antibody (NBP3-35578) (0)
There are no reviews for mtRNA polymerase Antibody (NBP3-35578).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for mtRNA polymerase Antibody (NBP3-35578) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional mtRNA polymerase Products
Blogs on mtRNA polymerase