MTMR12 Antibody

Images

 
Immunohistochemistry-Paraffin: MTMR12 Antibody [NBP2-13625] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MTMR12 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: RPEEIHTNEKEVTEKEVTLHLLPGEQLLCEASTVLKYVQEDSCQHGVYGRLVCTDFKIAFLGDDESALDNDETQFKNKVIGENDITLHCVDQIYGVFDE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MTMR12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MTMR12 Protein (NBP2-13625PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MTMR12 Antibody

  • 3-PAP3PAP
  • 3-phosphatase adapter subunit
  • KIAA1682FLJ20476
  • myotubularin related protein 12
  • myotubularin-related protein 12,3-phosphatase adapter protein
  • Phosphatidylinositol-3 phosphate 3-phosphatase adapter subunit
  • phosphatidylinositol-3 phosphate 3-phosphatase adaptor subunit
  • phosphatidylinositol-3-phosphate associated protein
  • PIP3AP

Background

MTMR12, also known as Myotubularin-related protein 12, has 3 isoforms, a 747 amino acid isoform that is 86 kDa, a 693 amino acid isoform that is 80 kda and a 637 amino acid isoform that is 73 kDa, cytoplasm located, ubiquitous with prominent expression in brain, heart, kidney, placenta, and lung; acts as an adaptor subunit in a complex with an active PtdIns(3)P 3-phosphatase for the phosphatase myotubularin to regulate myotubularin intracellular location. Current research is being performed on this protein involvement in cri-u-chat syndrome, cervix uteri carcinoma in situ, pelvic inflammatory disease, centronuclear myopathy, gonorrhea, myopathy, and carcinoma. This protein has shown an interaction with MTMR2, MTM1, KBTBD7, and UBC proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MTMR12 Antibody (NBP2-13625) (0)

There are no publications for MTMR12 Antibody (NBP2-13625).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTMR12 Antibody (NBP2-13625) (0)

There are no reviews for MTMR12 Antibody (NBP2-13625). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MTMR12 Antibody (NBP2-13625) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MTMR12 Products

Research Areas for MTMR12 Antibody (NBP2-13625)

Find related products by research area.

Blogs on MTMR12

There are no specific blogs for MTMR12, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MTMR12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MTMR12