MTMR12 Antibody

Images

 
Immunohistochemistry-Paraffin: MTMR12 Antibody [NBP2-13625] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MTMR12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RPEEIHTNEKEVTEKEVTLHLLPGEQLLCEASTVLKYVQEDSCQHGVYGR LVCTDFKIAFLGDDESALDNDETQFKNKVIGENDITLHCVDQIYGVFDE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MTMR12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MTMR12 Protein (NBP2-13625PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MTMR12 Antibody

  • 3-PAP3PAP
  • 3-phosphatase adapter subunit
  • KIAA1682FLJ20476
  • myotubularin related protein 12
  • myotubularin-related protein 12,3-phosphatase adapter protein
  • Phosphatidylinositol-3 phosphate 3-phosphatase adapter subunit
  • phosphatidylinositol-3 phosphate 3-phosphatase adaptor subunit
  • phosphatidylinositol-3-phosphate associated protein
  • PIP3AP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86113
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-19997
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00005725-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-56548
Species: Hu
Applications: ICC/IF
NBP2-33580
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-46403
Species: Hu
Applications: IHC
NBP1-81804
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-88447
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31365
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80601
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
MAB7670
Species: Hu
Applications: WB, ICC
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
AF2715
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13625
Species: Hu
Applications: IHC, IHC-P

Publications for MTMR12 Antibody (NBP2-13625) (0)

There are no publications for MTMR12 Antibody (NBP2-13625).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTMR12 Antibody (NBP2-13625) (0)

There are no reviews for MTMR12 Antibody (NBP2-13625). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MTMR12 Antibody (NBP2-13625) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MTMR12 Products

Bioinformatics Tool for MTMR12 Antibody (NBP2-13625)

Discover related pathways, diseases and genes to MTMR12 Antibody (NBP2-13625). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTMR12 Antibody (NBP2-13625)

Discover more about diseases related to MTMR12 Antibody (NBP2-13625).
 

Pathways for MTMR12 Antibody (NBP2-13625)

View related products by pathway.

PTMs for MTMR12 Antibody (NBP2-13625)

Learn more about PTMs related to MTMR12 Antibody (NBP2-13625).
 

Research Areas for MTMR12 Antibody (NBP2-13625)

Find related products by research area.

Blogs on MTMR12

There are no specific blogs for MTMR12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MTMR12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MTMR12