MTMR12 Antibody

Images

 
Western Blot: MTMR12 Antibody [NBP1-55211] - COLO205 cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MTMR12 Antibody Summary

Immunogen
Synthetic peptides corresponding to MTMR12(myotubularin related protein 12) The peptide sequence was selected from the middle region of MTMR12. Peptide sequence PLYVEKPKLDKGQRKGMRFKHQRQLSLPLTQSKSSPKRGFFREETDHLIK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MTMR12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MTMR12 and was validated on Western blot.
Theoretical MW
86 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MTMR12 Antibody

  • 3-PAP3PAP
  • 3-phosphatase adapter subunit
  • KIAA1682FLJ20476
  • myotubularin related protein 12
  • myotubularin-related protein 12,3-phosphatase adapter protein
  • Phosphatidylinositol-3 phosphate 3-phosphatase adapter subunit
  • phosphatidylinositol-3 phosphate 3-phosphatase adaptor subunit
  • phosphatidylinositol-3-phosphate associated protein
  • PIP3AP

Background

MTMR12 inactives phosphatase that plays a role as an adapter for the phosphatase myotubularin to regulate myotubularin intracellular location.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86113
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-19997
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00005725-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-68976
Species: Hu
Applications: ICC/IF
NBP2-33580
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-19804
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75515
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00008131-M02
Species: Hu, Rt
Applications: WB, ELISA
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-31365
Species: Hu, Mu, Ch, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80601
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-38535
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7670
Species: Hu
Applications: WB, ICC
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2715
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-82454
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55211
Species: Hu
Applications: WB

Publications for MTMR12 Antibody (NBP1-55211) (0)

There are no publications for MTMR12 Antibody (NBP1-55211).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTMR12 Antibody (NBP1-55211) (0)

There are no reviews for MTMR12 Antibody (NBP1-55211). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MTMR12 Antibody (NBP1-55211) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for MTMR12 Antibody (NBP1-55211)

Discover related pathways, diseases and genes to MTMR12 Antibody (NBP1-55211). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTMR12 Antibody (NBP1-55211)

Discover more about diseases related to MTMR12 Antibody (NBP1-55211).
 

Pathways for MTMR12 Antibody (NBP1-55211)

View related products by pathway.

PTMs for MTMR12 Antibody (NBP1-55211)

Learn more about PTMs related to MTMR12 Antibody (NBP1-55211).
 

Research Areas for MTMR12 Antibody (NBP1-55211)

Find related products by research area.

Blogs on MTMR12

There are no specific blogs for MTMR12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MTMR12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MTMR12
Uniprot