MTERF Antibody (1A3)

Images

 
There are currently no images for MTERF Antibody (H00007978-M01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
1A3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MTERF Antibody (1A3) Summary

Immunogen
MTERF (NP_008911, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MQSLSLGQTSISKGLNYLTIMAPGNLWHMRNNFLFGSRCWMTRFSAENIFKSVSFRLFGVKCHNTDSEPLKNEDLLKNLLTMGVDIDMARKRQPGVFHRM
Specificity
MTERF (1A3)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MTERF
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MTERF Antibody (1A3)

  • MGC131634
  • Mitochondrial transcription termination factor 1
  • mitochondrial transcription termination factor
  • mitochondrial
  • mTERF

Background

This gene encodes a mitochondrial transcription termination factor. This protein participates in attenuating transcription from the mitochondrial genome; this attenuation allows higher levels of expression of 16S ribosomal RNA relative to the tRNA gene downstream. The product of this gene has three leucine zipper motifs bracketed by two basic domains that are all required for DNA binding. There is evidence that, for this protein, the zippers participate in intramolecular interactions that establish the three-dimensional structure required for DNA binding.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-71648
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-82241
Species: Hu
Applications: WB, IHC, IHC-P
H00051001-P01
Species: Hu
NBP2-13429
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82733
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-19586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-82114
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-19436
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47405
Species: Hu
Applications: IHC, IHC-P
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46383
Species: Hu
Applications: WB, Flow, IHC
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
H00007978-M01
Species: Hu
Applications: ELISA

Publications for MTERF Antibody (H00007978-M01) (0)

There are no publications for MTERF Antibody (H00007978-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTERF Antibody (H00007978-M01) (0)

There are no reviews for MTERF Antibody (H00007978-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MTERF Antibody (H00007978-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MTERF Products

Bioinformatics Tool for MTERF Antibody (H00007978-M01)

Discover related pathways, diseases and genes to MTERF Antibody (H00007978-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTERF Antibody (H00007978-M01)

Discover more about diseases related to MTERF Antibody (H00007978-M01).
 

Pathways for MTERF Antibody (H00007978-M01)

View related products by pathway.

PTMs for MTERF Antibody (H00007978-M01)

Learn more about PTMs related to MTERF Antibody (H00007978-M01).

Blogs on MTERF

There are no specific blogs for MTERF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MTERF Antibody (1A3) and receive a gift card or discount.

Bioinformatics

Gene Symbol MTERF
Entrez
OMIM
Uniprot