MST3 Antibody


Western Blot: MST3 Antibody [NBP1-87834] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87834] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Western Blot: MST3 Antibody [NBP1-87834] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

MST3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: QCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGG
Specificity of human, mouse, rat MST3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MST3 Protein (NBP1-87834PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MST3 Antibody

  • EC 2.7.11
  • EC
  • Mammalian STE20-like protein kinase 3
  • MST-3
  • MST3serine/threonine kinase 24 (Ste20, yeast homolog)
  • serine/threonine kinase 24
  • serine/threonine-protein kinase 24
  • STE20
  • STE20-like kinase 3
  • STE20-like kinase MST3
  • sterile 20-like kinase 3
  • STK3yeast)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, PLA
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Hu

Publications for MST3 Antibody (NBP1-87834) (0)

There are no publications for MST3 Antibody (NBP1-87834).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MST3 Antibody (NBP1-87834) (0)

There are no reviews for MST3 Antibody (NBP1-87834). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MST3 Antibody (NBP1-87834) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MST3 Products

Bioinformatics Tool for MST3 Antibody (NBP1-87834)

Discover related pathways, diseases and genes to MST3 Antibody (NBP1-87834). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MST3 Antibody (NBP1-87834)

Discover more about diseases related to MST3 Antibody (NBP1-87834).

Pathways for MST3 Antibody (NBP1-87834)

View related products by pathway.

PTMs for MST3 Antibody (NBP1-87834)

Learn more about PTMs related to MST3 Antibody (NBP1-87834).

Research Areas for MST3 Antibody (NBP1-87834)

Find related products by research area.

Blogs on MST3

There are no specific blogs for MST3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MST3 Antibody and receive a gift card or discount.


Gene Symbol STK24