MSL1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MSL1 Antibody [NBP1-90505] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: MSL1 Antibody [NBP1-90505] - Staining of human gallbladder shows nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MSL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FGSTERKTPVKKLAPEFSKVKTKTPKHSPIKEEPCGSLSETVCKRELRSQETPEKPRSSVDTPPRLSTPQKGPSTHPKEKAFSSEIEDLPYLSTTEMY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MSL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MSL1 Protein (NBP1-90505PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MSL1 Antibody

  • DKFZp686J17211
  • hMSL1
  • male-specific lethal 1 homolog (Drosophila)
  • male-specific lethal 1 homolog
  • male-specific lethal 1-like 1
  • male-specific lethal-1 homolog 1
  • MGC141861
  • MSL-1
  • MSL1L1
  • MSL1-like 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28879
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBL1-11569
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu
NBP2-10888
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBL1-11567
Species: Hu
H00010943-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
AF844
Species: Mu
Applications: WB, Block
NBP2-33447
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-51635
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-32281
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-90505
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for MSL1 Antibody (NBP1-90505) (0)

There are no publications for MSL1 Antibody (NBP1-90505).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MSL1 Antibody (NBP1-90505) (0)

There are no reviews for MSL1 Antibody (NBP1-90505). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MSL1 Antibody (NBP1-90505) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MSL1 Products

Bioinformatics Tool for MSL1 Antibody (NBP1-90505)

Discover related pathways, diseases and genes to MSL1 Antibody (NBP1-90505). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MSL1 Antibody (NBP1-90505)

Discover more about diseases related to MSL1 Antibody (NBP1-90505).
 

Pathways for MSL1 Antibody (NBP1-90505)

View related products by pathway.

PTMs for MSL1 Antibody (NBP1-90505)

Learn more about PTMs related to MSL1 Antibody (NBP1-90505).

Blogs on MSL1

There are no specific blogs for MSL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MSL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MSL1