Recombinant Human MSK1/RPS6KA5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MSK1/RPS6KA5 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 271-370 of Human RPS6KA5 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ILKSEPPYPQEMSALAKDLIQRLLMKDPKKRLGCGPRDADEIKEHLFFQKINWDDLAAKKVPAPFKPVIRDELDVSNFAEEFTEMDPTYSPAALPQSSEK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RPS6KA5

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MSK1/RPS6KA5 Protein

  • EC 2.7.11
  • MGC1911,90 kDa ribosomal protein S6 kinase 5
  • MSK1
  • MSK1EC 2.7.11.1
  • MSPK1
  • Nuclear mitogen- and stress-activated protein kinase 1
  • ribosomal protein S6 kinase alpha-5
  • ribosomal protein S6 kinase, 90kD, polypeptide 5
  • ribosomal protein S6 kinase, 90kDa, polypeptide 5
  • RLPK
  • RPS6KA5
  • RSKL
  • RSK-like protein kinase
  • S6K-alpha-5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
AF189
Species: Hu, Mu
Applications: WB, IHC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF1518
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB79671
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC

Publications for MSK1/RPS6KA5 Partial Recombinant Protein (H00009252-Q01) (0)

There are no publications for MSK1/RPS6KA5 Partial Recombinant Protein (H00009252-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MSK1/RPS6KA5 Partial Recombinant Protein (H00009252-Q01) (0)

There are no reviews for MSK1/RPS6KA5 Partial Recombinant Protein (H00009252-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MSK1/RPS6KA5 Partial Recombinant Protein (H00009252-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MSK1/RPS6KA5 Products

Bioinformatics Tool for MSK1/RPS6KA5 Partial Recombinant Protein (H00009252-Q01)

Discover related pathways, diseases and genes to MSK1/RPS6KA5 Partial Recombinant Protein (H00009252-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MSK1/RPS6KA5 Partial Recombinant Protein (H00009252-Q01)

Discover more about diseases related to MSK1/RPS6KA5 Partial Recombinant Protein (H00009252-Q01).
 

Pathways for MSK1/RPS6KA5 Partial Recombinant Protein (H00009252-Q01)

View related products by pathway.

PTMs for MSK1/RPS6KA5 Partial Recombinant Protein (H00009252-Q01)

Learn more about PTMs related to MSK1/RPS6KA5 Partial Recombinant Protein (H00009252-Q01).
 

Research Areas for MSK1/RPS6KA5 Partial Recombinant Protein (H00009252-Q01)

Find related products by research area.

Blogs on MSK1/RPS6KA5

There are no specific blogs for MSK1/RPS6KA5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MSK1/RPS6KA5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS6KA5
Entrez