Home » MRTO4 » MRTO4 Antibodies » MRTO4 Antibody (1C12)

MRTO4 Antibody (1C12)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: MRTO4 Antibody (1C12) [H00051154-M01] - C1orf33 monoclonal antibody (M01), clone 1C12 Analysis of C1orf33 expression in HepG2.
Western Blot: MRTO4 Antibody (1C12) [H00051154-M01] - C1orf33 monoclonal antibody (M01), clone 1C12 Analysis of C1orf33 expression in HepG2.
Immunocytochemistry/ Immunofluorescence: MRTO4 Antibody (1C12) [H00051154-M01] - Analysis of monoclonal antibody to C1orf33 on HepG2 cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: MRTO4 Antibody (1C12) [H00051154-M01] - Detection limit for recombinant GST tagged C1orf33 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
1C12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

MRTO4 Antibody (1C12) Summary

Immunogen
C1orf33 (AAH03013, 1 a.a. ~ 239 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPKSKRDKKVSLTKTAKKGLELKQNLIEELRKCVDTYKYLFIFSVANMRNSKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKRLRGEVGLLFTNRTKEEVNEWFTKYTEMDYARAGNKAAFTVSLDPGPLEQFPHSMEPQLRQLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKLFGYEMAEFKVTIKYMWDSQSGRFQQMGDDLPESASESTEESDSEDDD
Specificity
C1orf33 - chromosome 1 open reading frame 33
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MRTO4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MRTO4 Antibody (1C12)

  • C1orf33
  • chromosome 1 open reading frame 33
  • dJ657E11.4
  • mRNA turnover 4 homolog (S. cerevisiae)
  • mRNA turnover protein 4 homolog
  • MRT4, mRNA turnover 4, homolog (S. cerevisiae)
  • MRT4, mRNA turnover 4, homolog
  • MRT460S acidic ribosomal protein PO

Background

This gene encodes a protein sharing a low level of sequence similarity with ribosomal protein P0. While the precise function of the encoded protein is currently unknown, it appears to be involved in mRNA turnover and ribosome assembly.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

RPLP0 Antibody
NBP1-82859
Immunohistochemistry-Paraffin: RPLP0 Antibody [NBP1-82859] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: RPLP0 Antibody [NBP1-82859] - Staining of human skin shows weak to moderate cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: RPLP0 Antibody [NBP1-82859] - Staining of human fallopian tube shows weak cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DUSP12 Antibody
H00011266-D01P
Western Blot: DUSP12 Antibody [H00011266-D01P] - Analysis of DUSP12 expression in transfected 293T cell line by DUSP12 polyclonal antibody.Lane 1: DUSP12 transfected lysate(37.70 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: DUSP12 Antibody [H00011266-D01P] - Analysis of antibody to DUSP12 on HeLa cell. Antibody concentration 20 ug/ml.
Species: Hu
Applications: ICC/IF, WB
Myelin Protein
Zero Antibody
NB100-1607
Immunohistochemistry: Myelin Protein Zero Antibody [NB100-1607] - In the image (a lower power tissue section through an adult sciatic nerve), Myelin Protein Zero (brown staining) can be seen in all of the myelinating Schwann cells.
Immunocytochemistry/Immunofluorescence: Myelin Protein Zero Antibody [NB100-1607] - Immunohistochemical staining of P-zero on a 4.0% paraformaldehyde-fixed, paraffin-embedded tissue section through the sciatic nerve of an adult mouse. (Green) P0 concentration was 1:1000 dilution, followed by fluorescein-labeled goat anti-chicken IgY (1:500 dilution). Red is actin. Blue is DAPI nuclear counterstain.
(9 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
RPL12 Antibody
NBP1-82857
Immunocytochemistry/Immunofluorescence: RPL12 Antibody [NBP1-82857] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus.
Western Blot: RPL12 Antibody [NBP1-82857] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: RPL12 Antibody [NBP1-82857] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells and decidua cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Fumarase Antibody
NBP1-31336
Immunocytochemistry/Immunofluorescence: Fumarase Antibody [NBP1-31336] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: Fumarate hydratase protein stained by Fumarate hydratase antibody diluted at 1:500.Blue: Hoechst 33342 staining.
Western Blot: Fumarase Antibody [NBP1-31336] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Fumarate hydratase antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: Fumarase Antibody [NBP1-31336] - Representative western blots showing protein expression of fumarase and key enzymes in OXPHOS. VDAC was used as a loading control (n = 3). Image collected and cropped by CiteAb from the following publication (https://www.nature.com/articles/srep22788) licensed under a CC-BY licence.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Protamine 1
Antibody
NBP2-30949
Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining in human testis and endometrium tissues.. Corresponding PRM1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
RPLP1 Antibody
NBP1-81293
Immunohistochemistry-Paraffin: RPLP1 Antibody [NBP1-81293] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: RPLP1 Antibody [NBP1-81293] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: RPLP1 Antibody [NBP1-81293] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
RPLP2 Antibody
NBP2-15104
Immunocytochemistry/Immunofluorescence: RPLP2 Antibody [NBP2-15104] - Analysis of methanol-fixed A431, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: RPLP2 Antibody [NBP2-15104] - Human colon carcinoma, using RPLP2 antibody at 1:500 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Western Blot: RPLP2 Antibody [NBP2-15104] - Sample (30 ug of whole cell lysate) A: 293T 15% SDS PAGE diluted at 1:10000 The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

FABP8/M-FABP/Myelin P2
AF5866
Western blot shows lysates of human hippocampal and rat spinal cord tissue. PVDF membrane was probed with 1 µg/mL of Human FABP8 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5866) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for FABP8 at approximately 15 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 7.
FABP8 was detected in immersion fixed paraffin-embedded sections of human spinal cord using 15 µg/mL Human FABP8 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5866) overnight at 4 °C. Tissue was stained with the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
FABP8 was detected in immersion fixed paraffin-embedded sections of human brain (cortex) using Human FABP8 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5866) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: IHC, WB
Perforin Antibody
(CB5.4) - BSA Free
NBP1-97512
Western Blot: Perforin Antibody (CB5.4) [NBP1-97512] - Detection of perforin in the mouse T cell clone B6.1. (lane 1). Absence of perforin in the mouse fibroblast cell line NIH.3T3 (lane 2). The protein migrates as a 66 kDa species. Method: Cell extracts from the T cell clone B6.1 (2x10^6) were resolved by SDS-PAGE under reducing conditions, transferred to nitrocellulose and probed with the CB5.4 antibody at 1 ug/ml. Proteins were visualized using a peroxidase-conjugated antibody to rat IgG and a chemiluminescence detection system.
(6 Publications)
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
B3GALNT1 Antibody
NBP2-92677
Western Blot: B3GALNT1 Antibody [NBP2-92677] - Analysis of extracts of various cell lines, using B3GALNT1 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 1s.
Species: Hu, Mu, Rt
Applications: WB
RPL9 Antibody
NBP1-82853
Immunohistochemistry-Paraffin: RPL9 Antibody [NBP1-82853] - Staining of human breast shows moderate cytoplasmic positivity in glandular cells
Immunocytochemistry/Immunofluorescence: RPL9 Antibody [NBP1-82853] - Staining of mouse cerebellum shows positivity in Purkinje cells.
Immunocytochemistry/Immunofluorescence: RPL9 Antibody [NBP1-82853] - Staining of mouse lateral septum shows labelling of neurons.
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Exosome component
10 Antibody
NBP1-32870
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with EXOSC10 antibody diluted at 1:5000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-32870] - Paraffin-embedded Cal27 xenograft, using antibody at 1:100 dilution.
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Sample: 1000 ug 293T whole cell lysate/extract A. 30 ug 293T whole cell lysate/extract, B. Control with 2. 5 ug of preimmune rabbit IgG, C. Immunoprecipitation of EXOSC 10 protein by 2. 5 ug of EXOSC 10 antibody 7. 5% SDS-PAGE gel.
(2 Reviews)
(3 Publications)
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
RPL38 Antibody
NBP2-30693
Immunocytochemistry/Immunofluorescence: RPL38 Antibody [NBP2-30693] - Staining of human cell line HEK 293 shows positivity in cytoplasm.
Immunohistochemistry: RPL38 Antibody [NBP2-30693] - Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neuronal cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CD77 Synthase
Antibody
NBP1-90824
Immunocytochemistry/Immunofluorescence: CD77 Synthase Antibody [NBP1-90824] - Staining of human cell line MCF7 shows localization to mitochondria. Antibody staining is shown in green.
Western Blot: CD77 Synthase Antibody [NBP1-90824] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402588)
Species: Hu
Applications: ICC/IF, WB
PMEL17/SILV
Antibody (OTI10E5)
NBP1-47974
Western Blot: PMEL17/SILV Antibody (10E5) [NBP1-47974] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PMEL17/SILV(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PMEL17/SILV.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-PMEL17/SILV mouse monoclonal antibody.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded breast tissue using anti-PMEL17/SILV mouse monoclonal antibody.
(1 Review)
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NUCKS1 Antibody
NB100-74635
Immunohistochemistry-Paraffin: NUCKS1 Antibody [NB100-74635] - Detection of human NUCKS by immunohistochemistry. Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti- NUCKS (NB100-74635). Detection: DAB
Immunoprecipitation: NUCKS1 Antibody [NB100-74635] - Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: NUCKS1 antibody NB100-74635 used for IP at 3 ug per reaction. NUCKS was also immunoprecipitated by NUCKS1 antibody NB100-74634. For blotting immunoprecipitated NUCKS, NB100-74635 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
RSL1D1 Antibody
H00026156-B01P
Immunocytochemistry/Immunofluorescence: RSL1D1 Antibody [H00026156-B01P] - Analysis of purified antibody to RSL1D1 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: RSL1D1 Antibody [H00026156-B01P] - Analysis of RSL1D1 expression in A-431.
Western Blot: RSL1D1 Antibody [H00026156-B01P] - Analysis of RSL1D1 expression in transfected 293T cell line by RSL1D1 polyclonal antibody. Lane 1: RSL1D1 transfected lysate(53.9 KDa). Lane 2: Non-transfected lysate.
Species: Hu
Applications: ICC/IF, WB
LDLR Antibody (C7)
NBP1-78159
Immunocytochemistry/Immunofluorescence: LDL R Antibody (C7) [NBP1-78159] - Antibody was tested in HepG2 cells with FITC (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry: LDL R Antibody (C7) [NBP1-78159] - Analysis of an FFPE tissue section of human liver using LDL Receptor antibody (clone C7) with HRP-DAB based detection and hematoxylin counterstaining.
Immunocytochemistry/Immunofluorescence: LDL R Antibody (C7) [NBP1-78159] - Image from a customer review on porcine intestinal epithelial cells IPEC-J2.
(1 Review)
(20 Publications)
Species: Bv, Hu, Po, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, RIA, WB
Importin 11
Antibody
NBP2-49505
Immunohistochemistry-Paraffin: Importin 11 Antibody [NBP2-49505] - Analysis in human testis and skeletal muscle tissues. Corresponding RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Importin 11 Antibody [NBP2-49505] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Importin 11 Antibody [NBP2-49505] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for MRTO4 Antibody (H00051154-M01) (0)

There are no publications for MRTO4 Antibody (H00051154-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRTO4 Antibody (H00051154-M01) (0)

There are no reviews for MRTO4 Antibody (H00051154-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MRTO4 Antibody (H00051154-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRTO4 Products

Bioinformatics Tool for MRTO4 Antibody (H00051154-M01)

Discover related pathways, diseases and genes to MRTO4 Antibody (H00051154-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRTO4 Antibody (H00051154-M01)

Discover more about diseases related to MRTO4 Antibody (H00051154-M01).

Research Areas for MRTO4 Antibody (H00051154-M01)

Find related products by research area.

Blogs on MRTO4

There are no specific blogs for MRTO4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRTO4 Antibody (1C12) and receive a gift card or discount.


Bioinformatics

Gene Symbol MRTO4
Entrez
Uniprot