MRTO4 Antibody (1C12)

Images

 
Western Blot: MRTO4 Antibody (1C12) [H00051154-M01] - C1orf33 monoclonal antibody (M01), clone 1C12 Analysis of C1orf33 expression in HepG2.
Immunocytochemistry/ Immunofluorescence: MRTO4 Antibody (1C12) [H00051154-M01] - Analysis of monoclonal antibody to C1orf33 on HepG2 cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: MRTO4 Antibody (1C12) [H00051154-M01] - Detection limit for recombinant GST tagged C1orf33 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
1C12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MRTO4 Antibody (1C12) Summary

Immunogen
C1orf33 (AAH03013, 1 a.a. ~ 239 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPKSKRDKKVSLTKTAKKGLELKQNLIEELRKCVDTYKYLFIFSVANMRNSKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKRLRGEVGLLFTNRTKEEVNEWFTKYTEMDYARAGNKAAFTVSLDPGPLEQFPHSMEPQLRQLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKLFGYEMAEFKVTIKYMWDSQSGRFQQMGDDLPESASESTEESDSEDDD
Specificity
C1orf33 - chromosome 1 open reading frame 33
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MRTO4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MRTO4 Antibody (1C12)

  • C1orf33
  • chromosome 1 open reading frame 33
  • dJ657E11.4
  • mRNA turnover 4 homolog (S. cerevisiae)
  • mRNA turnover protein 4 homolog
  • MRT4, mRNA turnover 4, homolog (S. cerevisiae)
  • MRT4, mRNA turnover 4, homolog
  • MRT460S acidic ribosomal protein PO

Background

This gene encodes a protein sharing a low level of sequence similarity with ribosomal protein P0. While the precise function of the encoded protein is currently unknown, it appears to be involved in mRNA turnover and ribosome assembly.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82859
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00011266-D01P
Species: Hu
Applications: ICC/IF, WB
NB100-1607
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
NBP1-82857
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31336
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-81293
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-15104
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF5866
Species: Hu
Applications: IHC, WB
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-92677
Species: Hu, Mu, Rt
Applications: WB
NBP1-82853
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP2-30693
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90824
Species: Hu
Applications: ICC/IF, WB
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-74635
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
H00026156-B01P
Species: Hu
Applications: ICC/IF, WB
NBP1-78159
Species: Bv, Hu, Po, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, RIA, WB
NBP2-49505
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for MRTO4 Antibody (H00051154-M01) (0)

There are no publications for MRTO4 Antibody (H00051154-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRTO4 Antibody (H00051154-M01) (0)

There are no reviews for MRTO4 Antibody (H00051154-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MRTO4 Antibody (H00051154-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRTO4 Products

Bioinformatics Tool for MRTO4 Antibody (H00051154-M01)

Discover related pathways, diseases and genes to MRTO4 Antibody (H00051154-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRTO4 Antibody (H00051154-M01)

Discover more about diseases related to MRTO4 Antibody (H00051154-M01).

Research Areas for MRTO4 Antibody (H00051154-M01)

Find related products by research area.

Blogs on MRTO4

There are no specific blogs for MRTO4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRTO4 Antibody (1C12) and receive a gift card or discount.

Bioinformatics

Gene Symbol MRTO4
Entrez
Uniprot