MRPS9 Antibody - BSA Free

Western Blot: MRPS9 Antibody [NBP2-30501] - Analysis using Anti-MRPS9 antibody NBP2-30501 (A) shows similar pattern to independent antibody NBP2-30429 (B).

Immunocytochemistry/Immunofluorescence: MRPS9 Antibody [NBP2-30501] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.

Immunohistochemistry-Paraffin: MRPS9 Antibody [NBP2-30501] - Staining in human testis and pancreas tissues using anti-MRPS9 antibody. Corresponding MRPS9 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: MRPS9 Antibody [NBP2-30501] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: MRPS9 Antibody [NBP2-30501] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: MRPS9 Antibody [NBP2-30501] - Staining of human testis shows high expression.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MRPS9 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MRPS9 Antibody - BSA Free (NBP2-30501) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RLRHTAFVIPKKNVPTSKRETYTEDFIKKQIEEFNIGKRHLANMMGEDPETFTQEDIDRAIAYLFPSGLFEKRARPVMKHPE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPS9
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MRPS9 Protein (NBP2-30501PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MRPS9 Antibody - BSA Free

• mitochondrial ribosomal protein S9
• MRP-S9RPMS9S9mt28S ribosomal protein S9, mitochondrial

Background

MRPS9, also known as Mitochondrial Ribosomal Protein S9, contains a 46 kDa isoform that is 396 amino acids in length, and is involved in mitochondrial protein synthesis. Current research is being conducted on the relationship between MRPS9 and a variety of diseases and disorders, including Parkinson's disease, mycobacterium tuberculosis, pneumonia, and malaria. The protein is associated with translation, the peptide biosynthetic process, and the detection of DNA damage, and has been found to interact with several proteins, such as HAP1, RBM4B, ICT1, CCNDBP1, and MPHOSPH6.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPS9
• Uniprot:
  • P82933(Human)