MRPS9 Antibody

Images

 
Independent Antibodies: Western Blot: MRPS9 Antibody [NBP2-30501] - Analysis using Anti-MRPS9 antibody NBP2-30501 (A) shows similar pattern to independent antibody NBP2-30429 (B).
Immunocytochemistry/ Immunofluorescence: MRPS9 Antibody [NBP2-30501] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Orthogonal Strategies: Immunohistochemistry-Paraffin: MRPS9 Antibody [NBP2-30501] - Staining in human testis and pancreas tissues using anti-MRPS9 antibody. Corresponding MRPS9 RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: MRPS9 Antibody [NBP2-30501] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: MRPS9 Antibody [NBP2-30501] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: MRPS9 Antibody [NBP2-30501] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRPS9 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RLRHTAFVIPKKNVPTSKRETYTEDFIKKQIEEFNIGKRHLANMMGEDPETFTQEDIDRAIAYLFPSGLFEKRARPVMKHPE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRPS9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MRPS9 Protein (NBP2-30501PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MRPS9 Antibody

  • mitochondrial ribosomal protein S9
  • MRP-S9RPMS9S9mt28S ribosomal protein S9, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-88192
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-46191
Species: Dr, Hu, Mu
Applications: IP, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-02164
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF009
Species: Hu
Applications: IHC, WB
NBP2-00482
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-49350
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NBP2-00649
Species: Ca, Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-75398
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-30501
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MRPS9 Antibody (NBP2-30501) (0)

There are no publications for MRPS9 Antibody (NBP2-30501).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS9 Antibody (NBP2-30501) (0)

There are no reviews for MRPS9 Antibody (NBP2-30501). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MRPS9 Antibody (NBP2-30501) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRPS9 Products

Bioinformatics Tool for MRPS9 Antibody (NBP2-30501)

Discover related pathways, diseases and genes to MRPS9 Antibody (NBP2-30501). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on MRPS9

There are no specific blogs for MRPS9, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPS9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPS9
Uniprot