MRPS35 Antibody - Azide and BSA Free

Western Blot: MRPS35 Antibody [H00060488-B01P] - Analysis of MRPS35 expression in transfected 293T cell line by MRPS35 polyclonal antibody. Lane 1: MRPS35 transfected lysate(25.08 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MRPS35 Antibody - Azide and BSA Free Summary

• Immunogen: MRPS35 (AAH15862, 1 a.a. - 227 a.a.) full-length human protein. MAKEGNLELLKIPNFLHLTPVAIKKHCEALKDFCTEWPAALDSDEKCEKHFPIEIDCTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLVGERYCKTTDVLTIKTDRCPLRRQNYDYAVYLLTVLYHESWNTEEWEKSKTEADMEEYIWENSSSERNILETLLQMKAAEKNMEINKEELLGTKEIEEYKKSVVSLKNEEENENSISQYKESVKRLLNVT
• Specificity: MRPS35 - mitochondrial ribosomal protein S35,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: MRPS35
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MRPS35 Antibody - Azide and BSA Free

• 28S ribosomal protein S28, mitochondrial
• DKFZp762P093
• MDS023,28S ribosomal protein S35, mitochondrial
• MGC104278
• mitochondrial ribosomal protein S28
• mitochondrial ribosomal protein S35
• MRP-S28
• MRPS28S35mt
• MRP-S35
• S28mt

Background

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that has had confusing nomenclature in the literature. Pseudogenes corresponding to this gene are found on chromosomes 3p, 5q, and 10q. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPS35
• Entrez:
  • 60488(Human)
• Uniprot:
  • AAH15862(Human)