Recombinant Human MRPS22 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MRPS22 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 21-119 of Human MRPS22 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ERVCFRARIQPWHGGLLQPLPCSFEMGLPRRRFSSEAAESGSPETKKPTFMDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEATRQAV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MRPS22
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MRPS22 Protein

  • C3orf5GK002
  • COXPD5
  • GIBT
  • mitochondrial ribosomal protein S22
  • MRP-S2228S ribosomal protein S22, mitochondrial
  • RPMS22
  • S22mt

Background

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that does not seem to have a counterpart in prokaryotic and fungal-mitochondrial ribosomes. This gene lies telomeric of and is transcribed in the opposite direction from the forkhead box L2 gene. A pseudogene corresponding to this gene is found on chromosome Xq. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1277
Species: Hu, Mu, Ft
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IF, IHC-WhMt
NBP2-32384
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-345
Species: Hu
Applications: WB, ChIP, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006192-P01
Species: Hu
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP2-20228
Species: Hu, Ze
Applications: WB
NBP2-24530
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P, Flow-IC
NBP2-22298
Species: Hu, Mu
Applications: IP (-), WB, IHC-P
H00006201-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-58885
Species: Hu
Applications: WB, ICC/IF
NBP1-87797
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-92350
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31357
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13262
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6574
Species: Mu
Applications: WB
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MRPS22 Partial Recombinant Protein (H00056945-Q01) (0)

There are no publications for MRPS22 Partial Recombinant Protein (H00056945-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS22 Partial Recombinant Protein (H00056945-Q01) (0)

There are no reviews for MRPS22 Partial Recombinant Protein (H00056945-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRPS22 Partial Recombinant Protein (H00056945-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MRPS22 Products

Bioinformatics Tool for MRPS22 Partial Recombinant Protein (H00056945-Q01)

Discover related pathways, diseases and genes to MRPS22 Partial Recombinant Protein (H00056945-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPS22 Partial Recombinant Protein (H00056945-Q01)

Discover more about diseases related to MRPS22 Partial Recombinant Protein (H00056945-Q01).
 

Pathways for MRPS22 Partial Recombinant Protein (H00056945-Q01)

View related products by pathway.

Blogs on MRPS22

There are no specific blogs for MRPS22, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FOXL2 Antibody
NB100-1277
MRPS22 Antibody
NBP1-86787

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MRPS22 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPS22