Recombinant Human MRPS12 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MRPS12 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-138 of Human MRPS12 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSWSGLLHGLNTSLTCGPALVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVRGKYDCGHVQKK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
MRPS12

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MRPS12 Protein

  • 28S ribosomal protein S12, mitochondrial
  • mitochondrial ribosomal protein S12
  • MPR-S12
  • MRP-S12
  • MT-RPS12
  • ribosomal protein, mitochondrial, S12
  • RPMS12
  • RPS12
  • RPSM12S12mt

Background

MRPS12( AAH01617, 1 a.a. - 139 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
H00006201-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-33807
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87797
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP2-36751
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89557
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006187-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00010153-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31357
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57365
Species: Hu
Applications: WB
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
H00006183-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for MRPS12 Recombinant Protein (H00006183-P01) (0)

There are no publications for MRPS12 Recombinant Protein (H00006183-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS12 Recombinant Protein (H00006183-P01) (0)

There are no reviews for MRPS12 Recombinant Protein (H00006183-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRPS12 Recombinant Protein (H00006183-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MRPS12 Products

Bioinformatics Tool for MRPS12 Recombinant Protein (H00006183-P01)

Discover related pathways, diseases and genes to MRPS12 Recombinant Protein (H00006183-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPS12 Recombinant Protein (H00006183-P01)

Discover more about diseases related to MRPS12 Recombinant Protein (H00006183-P01).
 

Pathways for MRPS12 Recombinant Protein (H00006183-P01)

View related products by pathway.

PTMs for MRPS12 Recombinant Protein (H00006183-P01)

Learn more about PTMs related to MRPS12 Recombinant Protein (H00006183-P01).

Blogs on MRPS12

There are no specific blogs for MRPS12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

COX-2 Antibody
NB100-689
MRPS12 Antibody
NBP2-13620

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MRPS12 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPS12