We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

MRPS12 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related MRPS12 Peptides and Proteins

Order Details


    • Catalog Number
      NBP2-13620PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MRPS12 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MRPS12.

Source: E. coli

Amino Acid Sequence: MSWSGLLHGLNTSLTCGPALVPRLWATCSMATLNQMHRL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MRPS12
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13620.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MRPS12 Recombinant Protein Antigen

  • 28S ribosomal protein S12, mitochondrial
  • mitochondrial ribosomal protein S12
  • MPR-S12
  • MRP-S12
  • MT-RPS12
  • ribosomal protein, mitochondrial, S12
  • RPMS12
  • RPS12
  • RPSM12S12mt

Background

MRPS12, also known as Mitochondrial Ribosomal Protein S12, consists of a 138 amino acid isoform that is 15 kDa, and is involved in the synthesis of proteins within the mitochondria, though its specific purpose is unknown. MRPS12 is currently being used in research with several diseases and disorders, such as autosomal dominant nonsyndromic deafness, esophageal carcinoma, mycobacterium tuberculosis, esophagitis, pneumonia, carcinoma, malaria, and sensorineural hearing loss, to determine its relationship with each condition. MRPS12 interacts with SPINK7, C14orf1, UNC119, CRMP1, and LRIF1 during the process of translation.(provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38780
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
H00006201-M03
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP2-20262
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87797
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, Simple Western, WB
NBP2-54591
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, PA
NBP2-36751
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-33691
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-03323
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MAB4470
Species: All-Multi
Applications: Flow, ICC, IHC, WB
H00006187-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-47525
Species: Hu
Applications: ChIP-EXO-SEQ, IHC,  IHC-P, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-85500
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-94502
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP3-05578
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-84847
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB

Publications for MRPS12 Protein (NBP2-13620PEP) (0)

There are no publications for MRPS12 Protein (NBP2-13620PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS12 Protein (NBP2-13620PEP) (0)

There are no reviews for MRPS12 Protein (NBP2-13620PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MRPS12 Protein (NBP2-13620PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MRPS12 Products

Blogs on MRPS12

There are no specific blogs for MRPS12, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MRPS12 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPS12