MRPL47 Antibody

Images

 
Western Blot: MRPL47 Antibody [NBP2-55844] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: MRPL47 Antibody [NBP2-55844] - Staining of human cell line CACO-2 shows localization to mitochondria.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRPL47 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YNRKRFFALPYVDHFLRLEREKRARIKARKENLERKKAKILLKKFPHLAEAQKSSLV
Specificity
Specificity of human MRPL47 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRPL47
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MRPL47 Antibody

  • CGI-204
  • L47mt
  • MGC45403
  • mitochondrial ribosomal protein L47
  • MRP-L47
  • nasopharyngeal carcinoma metastasis-related 1
  • Nasopharyngeal carcinoma metastasis-related protein 1
  • NCM139S ribosomal protein L47, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2357
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P, IP
NB110-55290
Species: Hu, Mu, Rt, Po, Ch, Ze
Applications: WB, Simple Western, IB, IHC, IHC-P
NBP2-13608
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59892
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, IHC, IHC-P
NBP1-59496
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
NBP1-71775
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81254
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MRPL47 Antibody (NBP2-55844) (0)

There are no publications for MRPL47 Antibody (NBP2-55844).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPL47 Antibody (NBP2-55844) (0)

There are no reviews for MRPL47 Antibody (NBP2-55844). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MRPL47 Antibody (NBP2-55844) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MRPL47 Products

Bioinformatics Tool for MRPL47 Antibody (NBP2-55844)

Discover related pathways, diseases and genes to MRPL47 Antibody (NBP2-55844). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPL47 Antibody (NBP2-55844)

Discover more about diseases related to MRPL47 Antibody (NBP2-55844).
 

Pathways for MRPL47 Antibody (NBP2-55844)

View related products by pathway.

Research Areas for MRPL47 Antibody (NBP2-55844)

Find related products by research area.

Blogs on MRPL47

There are no specific blogs for MRPL47, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPL47 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPL47