MRPL3 Antibody - BSA Free

Immunohistochemistry-Paraffin: MRPL3 Antibody [NBP2-13613] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: MRPL3 Antibody [NBP2-13613] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: MRPL3 Antibody [NBP2-13613] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: MRPL3 Antibody [NBP2-13613] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MRPL3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MRPL3 Antibody - BSA Free (NBP2-13613) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: GKSGTWWDEHLSEENVPFIKQLVSDEDKAQLASKLCPLKDEPWPIHPWEPGSFRVGLIALKLGMMPLWTKDGQKHVVTLLQVQDCHVLKYTSKENCNGK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPL3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MRPL3 Protein (NBP2-13613PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MRPL3 Antibody - BSA Free

• 39S ribosomal protein L3, mitochondrial
• mitochondrial ribosomal protein L3
• MRL3mitochondrial, L3
• RPML3

Background

MRPL3, also known as 39 S ribosomal protein L3, mitochondrial, is a 38.6 kDa, 348 amino acid protein that, when defected, causes a mitochondrial disease that results poor health, mental retardation, and, in some cases, death in infancy. Current research is observing the effects of the protein on diseases and disorders such as pneumonia, cardiomyopathy, mycobacterium tuberculosis, and malaria. The protein interacts with other proteins such as PUS1, DAP3, ICT1, MRPL13, and MRPL2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPL3