MRPL28 Antibody (3B9F2)

Western Blot: MRPL28 Antibody (3B9F2) [NBP3-15267] - Analysis of extracts of various cell lines, using MRPL28 antibody (NBP3-15267) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunocytochemistry/Immunofluorescence: MRPL28 Antibody (3B9F2) [NBP3-15267] - Immunofluorescence analysis of PC-12 cells using MRPL28 Rabbit mAb (NBP3-15267) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: MRPL28 Antibody (3B9F2) [NBP3-15267] - Immunofluorescence analysis of NIH/3T3 cells using MRPL28 Rabbit mAb (NBP3-15267) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunoprecipitation: MRPL28 Antibody (3B9F2) [NBP3-15267] - Analysis of 300ug extracts of K-562 cells using 3ug MRPL28 antibody (NBP3-15267). Western blot was performed from the immunoprecipitate using MRPL28 antibody (NBP3-15267) at a dilition of 1:1000.

Western Blot: MRPL28 Antibody (3B9F2) [MRPL28] - Western blot analysis of various lysates using MRPL28 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IP
• Clone: 3B9F2
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

MRPL28 Antibody (3B9F2) Summary

• Description: Novus Biologicals Rabbit MRPL28 Antibody (3B9F2) (NBP3-15267) is a recombinant monoclonal antibody validated for use in WB, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MRPL28 (NP_006419.2). MPLHKYPVWLWKRLQLREGICSRLPGHYLRSLEEERTPTPVHYRPHGAKFKINPKNGQRERVEDVPIPIYFPPESQRGLWGGEGWILGQIYANNDKLSKR
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: MRPL28
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunoprecipitation 1:500 - 1:1000
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MRPL28 Antibody (3B9F2)

• L28mt
• MAAT139S ribosomal protein L28, mitochondrial
• Melanoma antigen p15
• melanoma-associated antigen recognised by cytotoxic T lymphocytes
• Melanoma-associated antigen recognized by T lymphocytes
• MGC8499
• mitochondrial ribosomal protein L28
• MRP-L28
• p15

Background

MRPL28, also known as 39 S ribosomal protein L28, mitochondrial, is a 30.2 kDa, 256 amino acid protein that is utilized in mitochondrial ribosomes as a member of the ribosomal protein L28P family. Diseases and disorders such as hepatitis, leukemia, bronchitis, inflammatory bowel disease, melanoma, vaccinia, influenza, esophagitis, hepatocellular carcinoma, Hodgkin's lymphoma, and rheumatoid arthritis are beings studied with this protein. The protein interacts with ENSG00000258947, TUBB4A, OXA1L, ICT1, and TUBB3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPL28