MRG-binding protein Antibody

Images

 
Western Blot: MRG-binding protein Antibody [NBP1-55331] - Titration: 2.5ug/ml, Positive Control: Transfected 293T.

Product Details

Summary
Reactivity Hu, GpSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRG-binding protein Antibody Summary

Immunogen
Synthetic peptides corresponding to MRG-binding protein (N terminal).Peptide sequence: MGEAEVGGGGAAGDKGPGEAATSPAEETVVWSPEVEVCLFHAMLGHKPVG. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Guinea Pig (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRGBP
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against MRG-binding protein and was validated on Western blot.
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MRG-binding protein Antibody

  • chromosome 20 open reading frame 20
  • Eaf7
  • FLJ10914
  • MRG(MORF4-related gene)-binding protein
  • MRG15BP
  • MRG-binding protein
  • MRGBPURCC4

Background

MRG-binding protein is a component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1307
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-58076
Species: Hu
Applications: ICC/IF
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB100-79781
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-98552
Species: Hu
Applications: WB
NBP1-84063
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-92769
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56651
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
UL-812
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, ChIP, DB, ICC/IF
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-309
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, Single-Cell Western
H00085403-B01P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86099
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-16609
Species: Hu
Applications: WB, ICC/IF
NBP1-55331
Species: Hu, Gp
Applications: WB

Publications for MRG-binding protein Antibody (NBP1-55331) (0)

There are no publications for MRG-binding protein Antibody (NBP1-55331).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRG-binding protein Antibody (NBP1-55331) (0)

There are no reviews for MRG-binding protein Antibody (NBP1-55331). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRG-binding protein Antibody (NBP1-55331) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MRG-binding protein Products

Bioinformatics Tool for MRG-binding protein Antibody (NBP1-55331)

Discover related pathways, diseases and genes to MRG-binding protein Antibody (NBP1-55331). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRG-binding protein Antibody (NBP1-55331)

Discover more about diseases related to MRG-binding protein Antibody (NBP1-55331).
 

Pathways for MRG-binding protein Antibody (NBP1-55331)

View related products by pathway.

PTMs for MRG-binding protein Antibody (NBP1-55331)

Learn more about PTMs related to MRG-binding protein Antibody (NBP1-55331).
 

Research Areas for MRG-binding protein Antibody (NBP1-55331)

Find related products by research area.

Blogs on MRG-binding protein

There are no specific blogs for MRG-binding protein, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRG-binding protein Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRGBP
Uniprot