MPND Antibody (1C12) - Azide and BSA Free

Western Blot: MPND Antibody (1C12) [H00084954-M01] - Analysis of MPND expression in transfected 293T cell line by FLJ14981 monoclonal antibody (M01), clone 1C12.Lane 1: MPND transfected lysate (Predicted MW: 50.7 KDa).Lane 2: Non-transfected lysate.

ELISA: MPND Antibody (1C12) [H00084954-M01] - Detection limit for recombinant GST tagged MPND is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1C12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MPND Antibody (1C12) - Azide and BSA Free Summary

• Immunogen: FLJ14981 (NP_116257, 84 a.a. ~ 181 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ALLEPGAGVLSIYYLGKKFLGDLQPDGRIMWQETGQTFNSPSAWATHCKKLVNPAKKSGCGWASVKYKGQKLDKYKATWLRLHQLHTPATAADESPAS
• Specificity: FLJ14981 - hypothetical protein FLJ14981 (1C12)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MPND
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MPND Antibody (1C12) - Azide and BSA Free

• EC 3.4
• FLJ14981
• MPN domain containing
• MPN domain-containing protein

Background

MPND, also known as MPN domain-containing protein, is a 51kDa 471 amino acid protein with a shorter 49kDa 451 isoform. MPND is known to interact with USP30 and USP36.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MPND
• Entrez:
  • 84954(Human)
• Uniprot:
  • NP_116257(Human)