Recombinant Human Mohawk homeobox Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Mohawk homeobox Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-95 of Human Mohawk homeobox

Source: Wheat Germ

Amino Acid Sequence: MNTIVFNKLSSAVLFEDGGASERERGGRPYSGVLDSPHARPEVGIPDGPPLKDNLGLRHRRTGARQNGGKVRHKRQALQDMARPLKQWLYKHRDN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MKX
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.19 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Mohawk homeobox Protein

  • C10orf48
  • homeobox protein Mohawk
  • IFRX
  • Iroquois family related homeodomain protein
  • iroquois homeobox protein-like 1
  • IRXL1chromosome 10 open reading frame 48
  • MGC39616
  • mohawk homeobox

Background

IRXL1 - chromosome 10 open reading frame 48

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4368
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
MAB7555
Species: Hu
Applications: WB, Simple Western
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
NBP2-15396
Species: Hu
Applications: WB, IHC, IHC-P
AF5945
Species: Hu, Mu, Rt
Applications: WB
NBP1-92438
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-59987
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33415
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF2069
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-91952
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
AF6729
Species: Hu
Applications: WB, IHC, ICC
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29341
Species: Hu
Applications: WB, PEP-ELISA
AF1560
Species: Hu
Applications: WB, IHC, Neut
H00283078-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Mohawk homeobox Partial Recombinant Protein (H00283078-Q01) (0)

There are no publications for Mohawk homeobox Partial Recombinant Protein (H00283078-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mohawk homeobox Partial Recombinant Protein (H00283078-Q01) (0)

There are no reviews for Mohawk homeobox Partial Recombinant Protein (H00283078-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Mohawk homeobox Partial Recombinant Protein (H00283078-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Mohawk homeobox Products

Bioinformatics Tool for Mohawk homeobox Partial Recombinant Protein (H00283078-Q01)

Discover related pathways, diseases and genes to Mohawk homeobox Partial Recombinant Protein (H00283078-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mohawk homeobox Partial Recombinant Protein (H00283078-Q01)

Discover more about diseases related to Mohawk homeobox Partial Recombinant Protein (H00283078-Q01).
 

Pathways for Mohawk homeobox Partial Recombinant Protein (H00283078-Q01)

View related products by pathway.

Blogs on Mohawk homeobox

There are no specific blogs for Mohawk homeobox, but you can read our latest blog posts.

Customers Who Bought This Also Bought

EGR2 Antibody
NB110-59723

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Mohawk homeobox Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MKX