Mohawk homeobox Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Mohawk homeobox Antibody [NBP1-89912] - Immunofluorescent staining of human cell line HeLa shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: Mohawk homeobox Antibody [NBP1-89912] - Staining of human small intestine shows strong membranous and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Mohawk homeobox Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KTRQRNHSGSFSSNEFEEELVSPSSSETEGNFVYRTDTLENGSNKGESAANRKGPSKDDTYWKEINAAMALTNLAQGKDKLQGTTSCIIQKSSHIAEVKTVKVP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MKX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Mohawk homeobox Protein (NBP1-89912PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Mohawk homeobox Antibody

  • C10orf48
  • homeobox protein Mohawk
  • IFRX
  • Iroquois family related homeodomain protein
  • iroquois homeobox protein-like 1
  • IRXL1chromosome 10 open reading frame 48
  • MGC39616
  • mohawk homeobox

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4368
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
MAB7555
Species: Hu
Applications: WB, Simple Western
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
NBP1-82970
Species: Hu
Applications: WB, IHC, IHC-P
AF5945
Species: Hu, Mu, Rt
Applications: WB
NBP1-92438
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-59987
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33415
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF2069
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-91952
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
AF6729
Species: Hu
Applications: WB, IHC, ICC
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29341
Species: Mu
Applications: WB, PEP-ELISA
AF1560
Species: Hu
Applications: WB, IHC, Neut
NBP1-89912
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Mohawk homeobox Antibody (NBP1-89912) (0)

There are no publications for Mohawk homeobox Antibody (NBP1-89912).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mohawk homeobox Antibody (NBP1-89912) (0)

There are no reviews for Mohawk homeobox Antibody (NBP1-89912). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Mohawk homeobox Antibody (NBP1-89912) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Mohawk homeobox Products

Bioinformatics Tool for Mohawk homeobox Antibody (NBP1-89912)

Discover related pathways, diseases and genes to Mohawk homeobox Antibody (NBP1-89912). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mohawk homeobox Antibody (NBP1-89912)

Discover more about diseases related to Mohawk homeobox Antibody (NBP1-89912).
 

Pathways for Mohawk homeobox Antibody (NBP1-89912)

View related products by pathway.

Blogs on Mohawk homeobox

There are no specific blogs for Mohawk homeobox, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Mohawk homeobox Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MKX