Moesin Recombinant Protein Antigen

Images

 
There are currently no images for Moesin Protein (NBP1-90372PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Moesin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MSN.

Source: E. coli

Amino Acid Sequence: AELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDMIHAENMRLGRDKYKTLRQIRQGNTKQR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MSN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90372. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Moesin Recombinant Protein Antigen

  • Membrane-organizing extension spike protein
  • moesin

Background

Moesin (membrane-organizing extension spike protein) has previously been characterized as a possible receptor protein for heparan sulfate and also as a cytoskeletal linker protein that stabilizes cell surface microvilli, filopodia and lamellipodia. Data indicate that moesin is identical to the 77-kDa band that copurifies with ezrin in its isolation from human placenta (1). Members of the ezrin-radixin-moesin (ERM) family of membrane-cytoskeletal linking proteins have NH2- and COOH-terminal domains that associate with the plasma membrane and the actin cytoskeleton, respectively (2). It has been demonstrated that ezrin-radixin-moesin proteins are rapidly inactivated after antigen recognition through a Vav1-Rac1 pathway. The resulting disanchoring of the cortical actin cytoskeleton from the plasma membrane decreased cellular rigidity, leading to more efficient T cell-antigen-presenting cell conjugate formation (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16396
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC,  IHC-P, WB
H00005962-M06
Species: Ch, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP1-87757
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-58359
Species: Hu
Applications: IHC,  IHC-P, WB
BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
H00002035-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-35065
Species: Hu, Mu, Rt
Applications: ELISA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP3-15642
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-32822
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-67327
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-76847
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB

Publications for Moesin Protein (NBP1-90372PEP) (0)

There are no publications for Moesin Protein (NBP1-90372PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Moesin Protein (NBP1-90372PEP) (0)

There are no reviews for Moesin Protein (NBP1-90372PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Moesin Protein (NBP1-90372PEP). (Showing 1 - 1 of 1 FAQ).

  1. I am looking to use shRNA to inhibit Moesin expression. I have had people advise me that my initial MOI should be low as 'less is more' and 'a little goes a long way' in terms of siRNA. I was wondering if you could elaborate on this for me and explain why my initial MOI should be low.
    • The reason for a low MOI is most likely because RNAi is a very strong and efficient technique. Wikipedia does a good job of explaining <a href="http://en.wikipedia.org/wiki/RNA_interference" target="_blank">RNA interference</a>. However, I would imagine that in a cell, there will be at most 1-2 copies of the gene mRNA present at any given time, unless you're dealing with a highly expressed protein such as Actin, where I would imagine silencing Actin would be lethal to the cell. I can imagine a few reasons to not use too much siRNA. First, it is expensive, so you don't want to waste it. Second, using too much would cause there to be a lot of non-translatable RNA present in the cell, which could trigger an immune response, as the presence of uncapped RNAs can indicate presence of a virus and one of the TLRs may respond to this.

Additional Moesin Products

Research Areas for Moesin Protein (NBP1-90372PEP)

Find related products by research area.

Blogs on Moesin

There are no specific blogs for Moesin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Moesin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MSN