Recombinant Human Moesin Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Moesin Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 422 - 531 of Human MSN partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:AELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELAN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MSN

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Moesin Protein

  • Membrane-organizing extension spike protein
  • moesin

Background

MSN - moesin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16396
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31553
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00002035-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-536
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP, IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB2038
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76847
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for Moesin Partial Recombinant Protein (H00004478-Q01) (0)

There are no publications for Moesin Partial Recombinant Protein (H00004478-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Moesin Partial Recombinant Protein (H00004478-Q01) (0)

There are no reviews for Moesin Partial Recombinant Protein (H00004478-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Moesin Partial Recombinant Protein (H00004478-Q01). (Showing 1 - 1 of 1 FAQ).

  1. I am looking to use shRNA to inhibit Moesin expression. I have had people advise me that my initial MOI should be low as 'less is more' and 'a little goes a long way' in terms of siRNA. I was wondering if you could elaborate on this for me and explain why my initial MOI should be low.
    • The reason for a low MOI is most likely because RNAi is a very strong and efficient technique. Wikipedia does a good job of explaining <a href="http://en.wikipedia.org/wiki/RNA_interference" target="_blank">RNA interference</a>. However, I would imagine that in a cell, there will be at most 1-2 copies of the gene mRNA present at any given time, unless you're dealing with a highly expressed protein such as Actin, where I would imagine silencing Actin would be lethal to the cell. I can imagine a few reasons to not use too much siRNA. First, it is expensive, so you don't want to waste it. Second, using too much would cause there to be a lot of non-translatable RNA present in the cell, which could trigger an immune response, as the presence of uncapped RNAs can indicate presence of a virus and one of the TLRs may respond to this.

Additional Moesin Products

Bioinformatics Tool for Moesin Partial Recombinant Protein (H00004478-Q01)

Discover related pathways, diseases and genes to Moesin Partial Recombinant Protein (H00004478-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Moesin Partial Recombinant Protein (H00004478-Q01)

Discover more about diseases related to Moesin Partial Recombinant Protein (H00004478-Q01).
 

Pathways for Moesin Partial Recombinant Protein (H00004478-Q01)

View related products by pathway.

PTMs for Moesin Partial Recombinant Protein (H00004478-Q01)

Learn more about PTMs related to Moesin Partial Recombinant Protein (H00004478-Q01).
 

Research Areas for Moesin Partial Recombinant Protein (H00004478-Q01)

Find related products by research area.

Blogs on Moesin

There are no specific blogs for Moesin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Moesin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MSN